Align Serine hydroxymethyltransferase; SHMT; Serine methylase; L-threonine/L-allo-threonine aldolase; EC 2.1.2.1; EC 4.1.2.48 (characterized)
to candidate WP_029909421.1 P166_RS0105200 serine hydroxymethyltransferase
Query= SwissProt::D3DKC4 (427 letters) >NCBI__GCF_000711315.1:WP_029909421.1 Length = 431 Score = 492 bits (1266), Expect = e-143 Identities = 248/411 (60%), Positives = 309/411 (75%), Gaps = 8/411 (1%) Query: 8 DAEIYEAIVKEYERQFYHLELIASENFTSLAVMEAQGSVMTNKYAEGLPHKRYYGGCEFV 67 D + +AI E +RQ H+ELIASEN+TS VMEAQGSV+TNKYAEG P KRYYGGCEFV Sbjct: 12 DDVLADAIKSEAQRQEDHIELIASENYTSPRVMEAQGSVLTNKYAEGYPGKRYYGGCEFV 71 Query: 68 DIAEDLAIERAKALFDAEHANVQPHSGTQANMAVYMAVLKPGDTIMGMDLSHGGHLTHGA 127 D+ E LAI+RAK LF A++ANVQPHSG+QAN VYMA+L+PGDT++GM L+HGGHLTHG+ Sbjct: 72 DVVEQLAIDRAKELFGADYANVQPHSGSQANAPVYMALLEPGDTVLGMSLAHGGHLTHGS 131 Query: 128 KVNFSGKIYNAVYYGVHPETHLIDYDQLYRLAKEHKPKLIVGGASAYPRVIDWAKLREIA 187 V+FSGKIYNAV YG++PET IDY+++ RLAKEHKPK+I+ G SAY +V+DW + R+IA Sbjct: 132 HVSFSGKIYNAVQYGLNPETGEIDYEEVERLAKEHKPKMIIAGFSAYSQVVDWQRFRDIA 191 Query: 188 DSVGAYLMVDMAHYAGLIAGGVYPNPVPYAHFVTSTTHKTLRGPRSGFILCK--KEFAKD 245 D VGAYLMVDMAH AGL+A G YPNPV A T+TTHKTLRGPRSG IL K E K Sbjct: 192 DMVGAYLMVDMAHVAGLVAVGEYPNPVQIADVTTTTTHKTLRGPRSGLILAKANPEIEKK 251 Query: 246 IDKSVFPGIQGGPLMHVIAAKAVAFKEAMSQEFKEYARQVVANARVLAEEFIKEGFKVVS 305 ++ ++FPG QGGPLMHVIAAKAVAFKEAM EFK Y + V ANA+ +A+ F+ G+ VVS Sbjct: 252 LNSAIFPGAQGGPLMHVIAAKAVAFKEAMEPEFKTYIQNVKANAKAMAKVFMDRGYDVVS 311 Query: 306 GGTDSHIVLLDLRDTGLTGREVEEALGKANITVNKNAVPFDPLPPVKTSGIRLGTPAMTT 365 GT++H+ L+ GLTG+ V+ AL A+ITVNKN+VP DP+ P TSGIR+GT A TT Sbjct: 312 KGTENHLFLVSFIQQGLTGKLVDAALDAAHITVNKNSVPNDPMSPFVTSGIRIGTAASTT 371 Query: 366 RGMKEDQMRIIARLISKVIKNIG------DEKVIEYVRQEVIEMCEQFPLY 410 RG + +A + VI + DE+V++ VRQ+V +C P+Y Sbjct: 372 RGFTVEDSTNLANWMCDVIDSCSQDDGTWDEEVVDQVRQKVEALCADRPVY 422 Lambda K H 0.319 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 33 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 431 Length adjustment: 32 Effective length of query: 395 Effective length of database: 399 Effective search space: 157605 Effective search space used: 157605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory