Align Branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_051622951.1 P166_RS0103235 PLP-dependent aminotransferase family protein
Query= reanno::Koxy:BWI76_RS24235 (393 letters) >NCBI__GCF_000711315.1:WP_051622951.1 Length = 492 Score = 181 bits (459), Expect = 4e-50 Identities = 110/357 (30%), Positives = 170/357 (47%), Gaps = 6/357 (1%) Query: 18 VRELLKHSKLPGVISLGGGIPAPELFDTEGLNLAVQQVMNGRFNDAFQYGLTEGYPPLRQ 77 V L+K + P ++ G +P T+ + AV+Q Y G P LR+ Sbjct: 107 VLHLVKATNNPEMMQFGAAVPDASYLPTQLIAQAVRQAAKNDMAVLNDYLFPPGLPELRK 166 Query: 78 AVSELCQARGVACPASHVYITSGSQQSLDIVARTLLDPGDAIVVERPTYLAALQVFQLAQ 137 ++ A V ITSG Q+++ + R PGD I +E PT+ LQV + Sbjct: 167 QIARRMVGNACDVSAKQVVITSGCQEAIRLALRACAGPGDVIAIESPTFYGLLQVIHSLR 226 Query: 138 ANILSVDTD-DDGMLVEQLADLLETTRVKAVYLVPTFGNPGGKTLSEARRRRLVELAKKH 196 + + TD D GM +E L +E +KA LVP+F NP G ++ + ++ RLVEL K Sbjct: 227 MKAIEIPTDPDTGMSIEALEMAIEQWPIKACVLVPSFSNPLGLSMPDDKKSRLVELLSKR 286 Query: 197 DFVIIEDDPYGEISFTDEVRRPLYQYAVELGCEDQVVYTSTFSKILAPGMRIGWIVMPDW 256 + IIEDD YGEIS +PL + +D V+Y S+FSK L+PG+R+GW+V + Sbjct: 287 EIPIIEDDVYGEISHESPRPKPLKAF----DKDDWVIYCSSFSKTLSPGLRVGWVVSKRY 342 Query: 257 LAQQTVIVKQAADLHTNMLSQVITAEYLSMNRLESQIALIREDYRKKCVALADALESQLG 316 + K ++L T +SQ+ AE L + + ++ IR Y + A+ Sbjct: 343 Y-DKLEYFKYVSNLATASVSQLAVAEVLQSGKYDRYLSKIRSQYAYAVERMTAAIVKLFP 401 Query: 317 EHLEFSRPKGGMFLWARFRYPFDTMEWMKKTLENGVVYVPGEAFYNDNPDTRTLRLS 373 + +RPKGG LW + DT E + +++ + PG F N R+S Sbjct: 402 TGTKVTRPKGGFVLWIELPFKVDTFELANRLMKHQISIAPGRIFSTTNKYDHFFRIS 458 Lambda K H 0.320 0.136 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 492 Length adjustment: 32 Effective length of query: 361 Effective length of database: 460 Effective search space: 166060 Effective search space used: 166060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory