Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_084191423.1 U743_RS07150 alanine transaminase
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000733765.1:WP_084191423.1 Length = 414 Score = 157 bits (396), Expect = 7e-43 Identities = 115/359 (32%), Positives = 165/359 (45%), Gaps = 17/359 (4%) Query: 3 VSRLRPYATTVFAEMSALATRIGA--VNLGQGFPDEDGPP----KMLQAAQDAIAGGVNQ 56 + RL PY + ++ A G ++ G G PD P KM++AAQ ++ Sbjct: 29 IQRLPPYVFNIVGDLKKAARARGEDIIDFGMGNPDGPTPKHIVDKMVEAAQRP---DTHR 85 Query: 57 YPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIE 116 Y G LRRAIA ++HFGV+ DPE E + T+G+ E +A L + PG VL+ Sbjct: 86 YSVSRGVPRLRRAIATWYQQHFGVEIDPENEAIATIGSKEGLAHLALATLGPGDTVLVPN 145 Query: 117 PFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVT---PRTRALIINSPHNPTG 173 P Y + V +AGA V + PD F + L+RA+ P+ + LI+N P NPT Sbjct: 146 PAYPIHPYSVVIAGADIRHVRIGPDVDFF----EELQRAIRELWPKPKMLILNFPSNPTT 201 Query: 174 AVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKM 233 + IA + ++ D Y +VFD R + G + + + +K Sbjct: 202 QCVEREFFEKAVAIAREHEMWIVHDLAYADIVFDGYRAPSILEVPGAKDVAVESFTLSKS 261 Query: 234 FNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRA 293 +N GW++G+ G ELIA + K YL Y P Q A AL+ VA + + RA Sbjct: 262 YNMPGWRVGFMAGNRELIAALARIKSYLDYGMFTPIQVAAITALEGPQDCVAEITDIYRA 321 Query: 294 RRDRLAAGLTEIGFAVHDSYGTYFLCAD-PRPLGYDDSTEFCAALPEKVGVAAIPMSAF 351 RRD L GL +G+ V T F+ A P P S EF L + VA P F Sbjct: 322 RRDVLCDGLNALGWPVEKPKATMFVWARIPEPFRAMGSLEFSKKLLSEAKVAVSPGVGF 380 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 403 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 414 Length adjustment: 31 Effective length of query: 366 Effective length of database: 383 Effective search space: 140178 Effective search space used: 140178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory