Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_043766350.1 U743_RS05935 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_000733765.1:WP_043766350.1 Length = 394 Score = 345 bits (884), Expect = 2e-99 Identities = 181/388 (46%), Positives = 250/388 (64%), Gaps = 5/388 (1%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKY 74 A R++ I S L + A+AA ++ G+ V+ L AGEPDFDTPEHVK+AA A+ G+TKY Sbjct: 6 AVRVTRIKPSPTLAVTAKAAELRAAGEDVLSLAAGEPDFDTPEHVKEAAIRALRDGKTKY 65 Query: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPY 134 T + GTP LKKAI K R+NGL Y+ +I + G KQ +N A L+ GDEV+IP PY Sbjct: 66 TPVGGTPALKKAIIAKHARDNGLDYKASQILASVGGKQACYNVCQALLNAGDEVLIPAPY 125 Query: 135 WTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 W SY D+ + +G+PV+I A S F++T E LEAAITP +R + LNSPSNPSG AY+ A Sbjct: 126 WVSYPDMALLADGEPVIIPTTAESRFKMTPEALEAAITPNSRLLFLNSPSNPSGMAYTRA 185 Query: 195 DYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMT 254 + L EVLLRHP + + DDMYE I++ F P L RT+ ++ VSK Y+MT Sbjct: 186 ELAALGEVLLRHPRIVIASDDMYEKILWADEPFANIINACPELYERTVVIHAVSKTYSMT 245 Query: 255 GWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDL 314 GWR+G++ GP LI AMA +QSQ+TS P+SI+Q A++AAL G Q + E T +F+ R D Sbjct: 246 GWRLGWSAGPEWLIGAMANIQSQSTSNPTSIAQEAAIAALEGDQACVAEMTAAFRARHDK 305 Query: 315 VVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVP 374 +V GL+A+ G+ C +G FY F + + D + ++L+ A VA+VP Sbjct: 306 LVAGLSALPGVHCHAGDGTFYAFPDFSEAM-----HAAGFDDDVAYANHILDKAKVALVP 360 Query: 375 GSAFGLSPFFRISYATSEAELKEALERI 402 GSAFG R+S+AT+E+ L +A+ER+ Sbjct: 361 GSAFGSPGCMRLSFATAESVLDKAVERL 388 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 463 Number of extensions: 25 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 394 Length adjustment: 31 Effective length of query: 379 Effective length of database: 363 Effective search space: 137577 Effective search space used: 137577 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory