Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_084191423.1 U743_RS07150 alanine transaminase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_000733765.1:WP_084191423.1 Length = 414 Score = 170 bits (431), Expect = 6e-47 Identities = 121/384 (31%), Positives = 197/384 (51%), Gaps = 27/384 (7%) Query: 29 IGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGET-KYTALDGTPELKKAI 87 +G A + G+ +I G G PD TP+H+ +A R +T +Y+ G P L++AI Sbjct: 40 VGDLKKAARARGEDIIDFGMGNPDGPTPKHIVDKMVEAAQRPDTHRYSVSRGVPRLRRAI 99 Query: 88 REKFQRENGLAYELDEITVAT-GAKQILFNAMMASLDPGDEVIIPTPYWT--SYSDIVHI 144 +Q+ G+ + + +AT G+K+ L + +A+L PGD V++P P + YS ++ Sbjct: 100 ATWYQQHFGVEIDPENEAIATIGSKEGLAHLALATLGPGDTVLVPNPAYPIHPYSVVIAG 159 Query: 145 CEGKPVLIACDASSGFRLTAEKLEAAIT---PRTRWVLLNSPSNPSGAAYSAADYRPLLE 201 + + V I D E+L+ AI P+ + ++LN PSNP+ + + Sbjct: 160 ADIRHVRIGPDVDF-----FEELQRAIRELWPKPKMLILNFPSNPTTQCVEREFFEKAVA 214 Query: 202 VLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLE-PGLKNRTLTVNGVSKAYAMTGWRIGY 260 + H +W++ D Y IV+DG+R P+ LE PG K+ + +SK+Y M GWR+G+ Sbjct: 215 IAREH-EMWIVHDLAYADIVFDGYR--APSILEVPGAKDVAVESFTLSKSYNMPGWRVGF 271 Query: 261 AGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDLVVNGLN 320 G RELI A+A ++S + Q A++ AL GPQD + E T+ ++ RRD++ +GLN Sbjct: 272 MAGNRELIAALARIKSYLDYGMFTPIQVAAITALEGPQDCVAEITDIYRARRDVLCDGLN 331 Query: 321 AIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVPGSAFGL 380 A+ G P+ + ++ P R +F LL +A VAV PG FG Sbjct: 332 AL-GWPVEKPKATMFVWAR--------IPEPFRAMGSLEFSKKLLSEAKVAVSPGVGFGE 382 Query: 381 --SPFFRISYATSEAELKEALERI 402 + RIS +E ++AL I Sbjct: 383 YGDEYVRISLIENEHRTRQALRGI 406 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 20 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 414 Length adjustment: 31 Effective length of query: 379 Effective length of database: 383 Effective search space: 145157 Effective search space used: 145157 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory