Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_043766422.1 U743_RS06095 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000733765.1:WP_043766422.1 Length = 368 Score = 337 bits (864), Expect = 3e-97 Identities = 180/364 (49%), Positives = 235/364 (64%), Gaps = 9/364 (2%) Query: 5 DQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKHI 64 D+L R RID+LD I + + ERAR AQEV +K + ++ YRP REA VLK Sbjct: 4 DRLSQARSRIDALDAEIQERVVERARVAQEVRDIKREAGDLSDH---YRPAREAQVLKAA 60 Query: 65 MELNKG---PLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVIS 121 +E NK PL M + REIMS+CLALE PL V+YLGPEGT++Q+A KHFGH V + Sbjct: 61 VERNKALGSPLSQAAMTSIMREIMSACLALESPLSVSYLGPEGTYTQSAVYKHFGHQVST 120 Query: 122 KPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLL 181 + AID++FR+V +G +GVVPVENSTEG V+ TLD L + ICGEV L +HHHLL Sbjct: 121 RVAPAIDDIFRDVESGTAAYGVVPVENSTEGVVSSTLDLLLATPLSICGEVMLPVHHHLL 180 Query: 182 VGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAG 241 G RI +Y+H QS AQCR+WLD + PN R ++SN AA+RV AAIA Sbjct: 181 SGHEDMA-RIDVVYAHPQSFAQCRRWLDNNLPNTPREPMASNGAAARRVAETKRGAAIAS 239 Query: 242 DMAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVS--MRNKPGALHEL 299 A LYGL++LA IED P N+TRFL+IG Q+ PTG D+TS++ S +PGAL L Sbjct: 240 AAAGVLYGLNELAANIEDDPNNTTRFLVIGRQQPEPTGADRTSLVCSAPQGGEPGALFSL 299 Query: 300 LMPFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGS 359 L PF G++L++IE+RPSR W Y F++D GH DP + V++ + + K+LGS Sbjct: 300 LEPFAQAGVNLSKIESRPSRRAAWDYNFYLDLDGHQADPKVGAVIDDVRSRSAFFKILGS 359 Query: 360 YPKA 363 YP+A Sbjct: 360 YPRA 363 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 368 Length adjustment: 30 Effective length of query: 335 Effective length of database: 338 Effective search space: 113230 Effective search space used: 113230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory