Align Aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.79 (characterized)
to candidate WP_043766350.1 U743_RS05935 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::Q82WA8 (397 letters) >NCBI__GCF_000733765.1:WP_043766350.1 Length = 394 Score = 438 bits (1127), Expect = e-127 Identities = 220/394 (55%), Positives = 289/394 (73%), Gaps = 6/394 (1%) Query: 3 LSQRVQAIKPSPTLAVTAKAARLKAEGKNIIGLGAGEPDFDTPLHIKDAAITAIRNGFTK 62 L+ RV IKPSPTLAVTAKAA L+A G++++ L AGEPDFDTP H+K+AAI A+R+G TK Sbjct: 5 LAVRVTRIKPSPTLAVTAKAAELRAAGEDVLSLAAGEPDFDTPEHVKEAAIRALRDGKTK 64 Query: 63 YTAVGGTASLKQAIISKFKRENSLEFMPGEILVSSGGKQSFFNLVLATIDPGDEVIIPAP 122 YT VGGT +LK+AII+K R+N L++ +IL S GGKQ+ +N+ A ++ GDEV+IPAP Sbjct: 65 YTPVGGTPALKKAIIAKHARDNGLDYKASQILASVGGKQACYNVCQALLNAGDEVLIPAP 124 Query: 123 YWVSYPDIVLIAEGKPVFIDTGIEEKFKISPDQLEKAITPRTRMFVVNSPSNPSGSVYSL 182 YWVSYPD+ L+A+G+PV I T E +FK++P+ LE AITP +R+ +NSPSNPSG Y+ Sbjct: 125 YWVSYPDMALLADGEPVIIPTTAESRFKMTPEALEAAITPNSRLLFLNSPSNPSGMAYTR 184 Query: 183 EELQALGAVLRKYPDILIATDDMYEHILLSGDGFVNILNACPDLKARTVVLNGVSKAYAM 242 EL ALG VL ++P I+IA+DDMYE IL + + F NI+NACP+L RTVV++ VSK Y+M Sbjct: 185 AELAALGEVLLRHPRIVIASDDMYEKILWADEPFANIINACPELYERTVVIHAVSKTYSM 244 Query: 243 TGWRIGYCGGPAAIITAMENIQSQSTSNPNSIAQVAAEAALNGDQSCMVPMIEAFRERNQ 302 TGWR+G+ GP +I AM NIQSQSTSNP SIAQ AA AAL GDQ+C+ M AFR R+ Sbjct: 245 TGWRLGWSAGPEWLIGAMANIQSQSTSNPTSIAQEAAIAALEGDQACVAEMTAAFRARHD 304 Query: 303 FLTNALNSIAGIHCLLSEGAFYAFVDVRQAISRLNTQQILQNSSDIAFCNYVLEKAEVAA 362 L L+++ G+HC +G FYAF D +A+ D+A+ N++L+KA+VA Sbjct: 305 KLVAGLSALPGVHCHAGDGTFYAFPDFSEAMHAAGF------DDDVAYANHILDKAKVAL 358 Query: 363 VPGSAFGCEGYMRLSFATSMDNLQEAVKRIASLL 396 VPGSAFG G MRLSFAT+ L +AV+R+ LL Sbjct: 359 VPGSAFGSPGCMRLSFATAESVLDKAVERLGELL 392 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 395 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 394 Length adjustment: 31 Effective length of query: 366 Effective length of database: 363 Effective search space: 132858 Effective search space used: 132858 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory