Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_084191423.1 U743_RS07150 alanine transaminase
Query= BRENDA::Q8YTF2 (403 letters) >NCBI__GCF_000733765.1:WP_084191423.1 Length = 414 Score = 379 bits (972), Expect = e-109 Identities = 192/385 (49%), Positives = 253/385 (65%), Gaps = 3/385 (0%) Query: 7 TPADRIQQLPPYVFARLDELKAKAREQGIDLIDLGMGNPDGATPQPVVDAAIQALQDPKN 66 T RIQ+LPPYVF + +LK AR +G D+ID GMGNPDG TP+ +VD ++A Q P Sbjct: 24 TEFPRIQRLPPYVFNIVGDLKKAARARGEDIIDFGMGNPDGPTPKHIVDKMVEAAQRPDT 83 Query: 67 HGYPPFEGTASFRRAITNWYNRRYGVVLDPDSEALPLLGSKEGLSHLAIAYVNPGDVVLV 126 H Y G RRAI WY + +GV +DP++EA+ +GSKEGL+HLA+A + PGD VLV Sbjct: 84 HRYSVSRGVPRLRRAIATWYQQHFGVEIDPENEAIATIGSKEGLAHLALATLGPGDTVLV 143 Query: 127 PSPAYPAHFRGPVIAGGTVHSLILKPENDWLIDLTAIPEEVARKAKILYFNYPSNPTGAT 186 P+PAYP H VIAG + + + P+ D+ +L E+ K K+L N+PSNPT Sbjct: 144 PNPAYPIHPYSVVIAGADIRHVRIGPDVDFFEELQRAIRELWPKPKMLILNFPSNPTTQC 203 Query: 187 APREFFEEIVAFARKYEILLVHDLCYAELAFDGYQPTSLLEIPGAKDIGVEFHTLSKTYN 246 REFFE+ VA AR++E+ +VHDL YA++ FDGY+ S+LE+PGAKD+ VE TLSK+YN Sbjct: 204 VEREFFEKAVAIAREHEMWIVHDLAYADIVFDGYRAPSILEVPGAKDVAVESFTLSKSYN 263 Query: 247 MAGWRVGFVVGNRHVIQGLRTLKTNLDYGIFAALQTAAETALQLPDIYLHEVQQRYRTRR 306 M GWRVGF+ GNR +I L +K+ LDYG+F +Q AA TAL+ P + E+ YR RR Sbjct: 264 MPGWRVGFMAGNRELIAALARIKSYLDYGMFTPIQVAAITALEGPQDCVAEITDIYRARR 323 Query: 307 DFLIQGLGELGWDVPKTKATMYLWVKCPV---GMGSTDFALNLLQQTGVVVTPGNAFGVA 363 D L GL LGW V K KATM++W + P MGS +F+ LL + V V+PG FG Sbjct: 324 DVLCDGLNALGWPVEKPKATMFVWARIPEPFRAMGSLEFSKKLLSEAKVAVSPGVGFGEY 383 Query: 364 GEGYVRISLIADCDRLGEALDRIKQ 388 G+ YVRISLI + R +AL IK+ Sbjct: 384 GDEYVRISLIENEHRTRQALRGIKK 408 Lambda K H 0.321 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 403 Length of database: 414 Length adjustment: 31 Effective length of query: 372 Effective length of database: 383 Effective search space: 142476 Effective search space used: 142476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory