Align N-acetylornithine carbamoyltransferase (EC 2.1.3.9) (characterized)
to candidate WP_037571892.1 BS73_RS12735 ornithine carbamoyltransferase
Query= BRENDA::Q8P8J2 (339 letters) >NCBI__GCF_000744815.1:WP_037571892.1 Length = 337 Score = 119 bits (299), Expect = 8e-32 Identities = 111/359 (30%), Positives = 159/359 (44%), Gaps = 57/359 (15%) Query: 4 KHFLNTQDWSRAELDALLTQAALFKRNKL-GSE---LKGKSIALVFFNPSMRTRTSFELG 59 +HFL D++ E LL AA K K G+E L+G++IALVF S RTR SFE+ Sbjct: 8 RHFLKELDFTAQEFRFLLDLAAQLKAAKYAGTEQPRLRGRNIALVFEKGSTRTRCSFEVA 67 Query: 60 AFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFPKFVD 119 A G H L P +LG +E I + ARVLGR D I R Sbjct: 68 AADQGAHTTYLDPSGS------HLG------AKESIKDSARVLGRMFDGIQYRG------ 109 Query: 120 WSKDREDQVLKSFAKYSPVPVIN-METITHPCQELAHALALQEHFGTPDLRGKKYVLTWT 178 V++ A Y+ VPV N + HP Q LA L ++EH + GK T Sbjct: 110 ----HGQAVVEELAAYAGVPVWNGLTDEWHPTQMLADLLTIEEHNAATN--GKPLARTAL 163 Query: 179 YHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQVSHD 238 + + NS L MGMD+ ++ P + E + A + A SG + ++ D Sbjct: 164 AYLGDARNNMGNSLLVTGALMGMDIRIVAPESLWPTAEVRAE-AERLAARSGARITLTAD 222 Query: 239 IDSAYAGADVVYAKSWGALPFFGNWEPEKPIRDQYQHFIVDERKM----ALTNNGV-FSH 293 ++ AGAD VY W ++ EP++ ++ + + M A N GV F H Sbjct: 223 VEQGVAGADYVYTDVWVSM-----GEPKEVWAERIELLTPYQINMDVIRATGNPGVRFLH 277 Query: 294 CLPLRRN-----------------VKATDAVMDSPNCIAIDEAENRLHVQKAIMAALVG 335 CLP + ++ TD V +S + DEAENR+H KA++ A +G Sbjct: 278 CLPAFHDLGTQVARDLHATTGLTELEVTDEVFESEYSLVFDEAENRMHTIKAVLVATLG 336 Lambda K H 0.320 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 337 Length adjustment: 28 Effective length of query: 311 Effective length of database: 309 Effective search space: 96099 Effective search space used: 96099 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory