Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_034994118.1 DL88_RS07410 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_000745425.1:WP_034994118.1 Length = 400 Score = 165 bits (418), Expect = 2e-45 Identities = 121/398 (30%), Positives = 194/398 (48%), Gaps = 29/398 (7%) Query: 5 RLRPYATTVFAEMSALATRIG--AVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPG 62 R++P AT V + + G ++L G PD D P + QAA AI G +Y P G Sbjct: 10 RVKPSATIVVTQKARDLRNAGRDVISLSVGEPDFDTPDNIKQAAIRAIERGDTKYTPVAG 69 Query: 63 SAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSY 122 PLR AI + +R +DY P ++ +V G + A L V PG EV++ P++ SY Sbjct: 70 IIPLREAIVQKFKRENHLDYKP-SQTIVATGGKHILFNAFLATVNPGDEVIIPAPYWVSY 128 Query: 123 SPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELA 182 +VA+AG V V + +GF L + L RA+TPRT+ L+INSP NP+GA + E+ Sbjct: 129 PDMVAIAGGTPVFVETRIE-QGFKLQPEDLERAITPRTKWLLINSPSNPSGAAYTHAEMK 187 Query: 183 AIAEIAVA-ANLVVITDEVYEHLVF-DHARHLPLAGFDGMAERTITISSAAKMFNCTGWK 240 A+ ++ + + V+TD++YEHL++ D P + +RT+T++ +K ++ TGW+ Sbjct: 188 ALTDVLLCHPQVYVLTDDIYEHLIYGDFTFVTPAEVEPELIDRTLTMNGVSKAYSMTGWR 247 Query: 241 IGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAA 300 IG+A GP +LI + + + + Q A AL ++A R RRD + + Sbjct: 248 IGYAAGPEKLIKAMDMLQGQQTSGACSIAQWAAVEALTGPQDFIAERRRIFEERRDLVVS 307 Query: 301 GLTEIGF----AVHDSYGTYFLCA------DPRPLGYDDSTEFCAALPEKVGVAAIPMSA 350 L + + ++ Y CA ++ +F +AL + GVA + SA Sbjct: 308 MLNQAAYLKCPVPEGAFYVYPSCAAAIGKKTQEGKVIENDADFVSALLDAEGVAVVHGSA 367 Query: 351 FCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRL 388 F GQ R ++ L+EA R+ Sbjct: 368 F-----GQGPN--------FRISYATSTQVLEEACHRI 392 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 400 Length adjustment: 31 Effective length of query: 366 Effective length of database: 369 Effective search space: 135054 Effective search space used: 135054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory