GapMind for Amino acid biosynthesis

 

Alignments for a candidate for trpD_1 in Xenophilus azovorans DSM 13620

Align Anthranilate synthase component 2; AS; ASII; EC 4.1.3.27; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component (uncharacterized)
to candidate WP_038216896.1 Q392_RS28730 glutamine-hydrolyzing GMP synthase

Query= curated2:O28670
         (178 letters)



>NCBI__GCF_000745855.1:WP_038216896.1
          Length = 538

 Score = 62.0 bits (149), Expect = 2e-14
 Identities = 44/130 (33%), Positives = 61/130 (46%), Gaps = 11/130 (8%)

Query: 54  DRSLEFVFKMGVPVLGVCLGHQMIAEVFGGKV--------GRVE-PVHGKTSLVEHDGRG 104
           DR+ + VF++GVPVLG+C G Q +A+  GGKV        G  E    G T L++     
Sbjct: 68  DRAPQAVFELGVPVLGICYGMQTMAQQLGGKVEGSHQREFGYAEVRARGHTDLLKDIADV 127

Query: 105 IFKGVRNPLRAGRYHSLAVLEPPEGFEVCAKSEDGVVMGLRRGKIH--GVQFHPESVLTE 162
                   L+    H   V E P GF + A +    + G+     H  GVQFHPE   T+
Sbjct: 128 TTPEGHGMLKVWMSHGDKVTELPPGFRLMASTGSCPIAGMADEARHFYGVQFHPEVTHTQ 187

Query: 163 DGVRMIRNFV 172
            G  ++  FV
Sbjct: 188 QGRAILERFV 197


Lambda     K      H
   0.323    0.144    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 280
Number of extensions: 22
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 178
Length of database: 538
Length adjustment: 27
Effective length of query: 151
Effective length of database: 511
Effective search space:    77161
Effective search space used:    77161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory