Align cysteine synthase (EC 2.5.1.47); cystathionine beta-synthase (EC 4.2.1.22) (characterized)
to candidate WP_035239961.1 Q366_RS13780 cysteine synthase A
Query= BRENDA::F9UT54 (303 letters) >NCBI__GCF_000745975.1:WP_035239961.1 Length = 305 Score = 222 bits (566), Expect = 7e-63 Identities = 123/303 (40%), Positives = 179/303 (59%), Gaps = 7/303 (2%) Query: 3 IQHVQELIGHTPLMALPIEVPNH---SHIYAKLEMFNPGGSIKDRLGAYLIEDGLQRGRV 59 I ++ + G+TPL+ L E P+ + ++AKLE FNP GS+KDR+G +IE GL+ G++ Sbjct: 4 INNITQACGNTPLVYL--EAPSRECGADLFAKLEYFNPLGSVKDRVGLAMIEAGLKSGQI 61 Query: 60 NAKTTIIEPTAGNTGIGLALATQAHHLRTILVVPEKFSMEKQVLMQALGAEIVHTPSEEG 119 T I+EPT+GNTGI LA + + L +PE S+E+Q L++ LGA+++ TP G Sbjct: 62 GPDTLIVEPTSGNTGIALAFVARIKGCKLALTMPETMSLERQKLLRHLGAQLILTPGHLG 121 Query: 120 IKGAIRKAEALAATISNSYVPMQFKNPANPAAYYHTLAPEILADMPAPITAFVAGAGSGG 179 ++GA+ KA + A N+Y+P QF NPANPAA+ T PEI + FVAG G+GG Sbjct: 122 MQGAVDKAAEMVAAHENAYMPDQFSNPANPAAHRTTTGPEIWEAAQGRVDIFVAGVGTGG 181 Query: 180 TFAGVAAYLQAQDSATKAVVVEP-EGSILNGGPAHAHRTEGIGVEFIPPFFDQVRIDQTL 238 T GV Y++ + +V VEP E +L+GG A H +GIG FIP ++ +D+ Sbjct: 182 TLTGVTEYIKGKQPDLMSVAVEPAESPVLSGGKAGPHAIQGIGAGFIPANLNRDLVDRIF 241 Query: 239 TIADNDAFAQVRHLARDHGLLIGSSSGAALAASLQLATNLPANSHIVTIFPDSSERYLSQ 298 + DA R LA+ G+L G SSGA A+ Q P + IV I D+ ERY+S Sbjct: 242 PVKGEDAINGARTLAKSCGILCGISSGANFHAAFQTGRRHPGKT-IVFIVCDTGERYIST 300 Query: 299 KIY 301 ++ Sbjct: 301 NLF 303 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 305 Length adjustment: 27 Effective length of query: 276 Effective length of database: 278 Effective search space: 76728 Effective search space used: 76728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory