Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_017752781.1 PN53_RS06145 PLP-dependent aminotransferase family protein
Query= BRENDA::A0A060PQX5 (417 letters) >NCBI__GCF_000816635.1:WP_017752781.1 Length = 481 Score = 197 bits (500), Expect = 7e-55 Identities = 118/369 (31%), Positives = 198/369 (53%), Gaps = 10/369 (2%) Query: 46 VISLAGGLPAPETFPVEIIAEITKEVLEKHAAQALQYGTTKGFTPLRLALAEWMRKRYDI 105 +IS P + F VE + + + + L YG +G+ L L ++M + I Sbjct: 118 MISFKSIAPDDKLFDVENFKKSFLNCISREGGKILNYGYAQGYKSLIKYLLKYMENK-GI 176 Query: 106 PISKVDIMITSGSQQALDLIGRVFINPGDIVVVEAPTYLAALQAFKYYEPEFVQIPLDDE 165 ++ DI+IT+G + DLI N GD V+ E PT+ A++ K ++ V + +D++ Sbjct: 177 NTTEKDIIITNGFTEGFDLILSCLTNAGDSVICENPTHNTAIKIMKLHKLNIVGVAMDED 236 Query: 166 GMRVDLLEEKLQELEKEGKKVKLVYTIPTFQNPAGVTMSEKRRKRLLELASEYDFLIVED 225 G+ + L+ KL +K KL Y IP++ NP G+ M ++R +L + E + IVED Sbjct: 237 GINLKDLKIKLTR-----QKPKLSYFIPSYHNPTGIVMPPEKRTKLYNILRENNIPIVED 291 Query: 226 NPYGELRYSGEPVKPIKAWDDEGR-VMYLGTFSKILAPGFRIGWIAAEPHLIRKLEIAKQ 284 ELRY + V PI A G V+Y+G+FSKIL PG RIGWI A+ LI +E K+ Sbjct: 292 GFNEELRYLSDHVSPIAALSGNGNSVIYIGSFSKILFPGIRIGWILADKQLIGYIESLKR 351 Query: 285 SVDLCTNPFSQVIAWKYVEGGHLDNHIPNIIEFYKPRRDAMLKALEEFMPEGVRWTKPEG 344 S ++ T+ Q + + Y++ G+ + +I + FYK + + + +++P + EG Sbjct: 352 SRNIHTSFLDQAVFYDYLKEGNFEKYIKKVRRFYKDKYEKAIDFARKYIPYSKIY--GEG 409 Query: 345 GMFVWVTLPEGIDTKLMLEKAVAKGVAYVPGEAFFAHRDVKNTMRLNFTYVPEEKIREGI 404 G+ +++ + GID++ +L + +GV + PG+ F+ NT RL F+ V +E I G Sbjct: 410 GLHIFIEV-YGIDSRKLLNRCCKRGVIFTPGDIFYTDGGGGNTFRLGFSRVSDEDIERGF 468 Query: 405 KRLAETIKE 413 K + E IK+ Sbjct: 469 KIIGEEIKK 477 Lambda K H 0.318 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 477 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 481 Length adjustment: 33 Effective length of query: 384 Effective length of database: 448 Effective search space: 172032 Effective search space used: 172032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory