Align Putative branched-chain-amino-acid aminotransferase; BCAT; EC 2.6.1.42; Transaminase B (uncharacterized)
to candidate WP_039653379.1 PN53_RS11780 D-amino acid aminotransferase
Query= curated2:Q58414 (288 letters) >NCBI__GCF_000816635.1:WP_039653379.1 Length = 280 Score = 119 bits (298), Expect = 8e-32 Identities = 86/275 (31%), Positives = 139/275 (50%), Gaps = 9/275 (3%) Query: 4 YLNGKFVDEKDAKVSVFDHGLLYGDGVFEGIRAYDGVVFMLKEHIDRLYDSAKSLCIDIP 63 Y NGK+ ++ + + D +GDGV++ + + V+F L EHIDR ++SA L I IP Sbjct: 6 YYNGKYDLIENMTIPMNDRACYFGDGVYDAAFSRNNVIFALDEHIDRFFNSAGLLRIKIP 65 Query: 64 LTKEEMIDVVLETLRVNNLRDAYIRLVVTRGVGDLG-LDPRKCGKPTIFCIAIPMPPLLG 122 TK+E+ ++++ ++ + + ++ VTRG + P K I+ P Sbjct: 66 YTKDELKTLLIDMVKKVDAVEQFVYWQVTRGTAMRDHVFPGDDVKANIWITLEPWNIEYK 125 Query: 123 EDGIRAITVSVRRLPVDVLNPAVKSLNYLNSVLAKIQANYAGVDEA-FLLDDKGFVVEGT 181 + ++ IT+ R L +K+LN L +V+A +A + E F D+ V E Sbjct: 126 QQKLKLITLEDTRF----LYCNIKTLNLLPNVMAAQKAKESNCQETVFHRGDR--VTECA 179 Query: 182 GDNIFIVKNGVLKTPPVYQSILKGITRDVVIKLAKEEGIEVVEEPLTLHDLYTADELFIT 241 N+ I+K+G+ KT P IL GI R +IK+ K GI V E P L +L ADE+ +T Sbjct: 180 HSNVSIIKDGIFKTAPTDNLILPGIARAHIIKMCKRFGIPVDETPFVLRELMDADEVIVT 239 Query: 242 GTAAEIVPVFEIDGRVINNKQVGEITKKLKEKFKD 276 + + EIDG+ + K EI +KL+ D Sbjct: 240 SSGDFCMTACEIDGKPVGGK-APEIVEKLQNALVD 273 Lambda K H 0.321 0.143 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 211 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 280 Length adjustment: 26 Effective length of query: 262 Effective length of database: 254 Effective search space: 66548 Effective search space used: 66548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory