Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate WP_041100966.1 SUTH_RS17015 glutamate-1-semialdehyde 2,1-aminomutase
Query= BRENDA::A0A140N9B6 (406 letters) >NCBI__GCF_000828635.1:WP_041100966.1 Length = 425 Score = 135 bits (340), Expect = 2e-36 Identities = 104/334 (31%), Positives = 156/334 (46%), Gaps = 23/334 (6%) Query: 21 APFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTN 80 AP G G+R+ D GKEYID+ G LGHA + A+ E A K G Sbjct: 32 APCFFASGSGARVRDADGKEYIDYVGSWGPLILGHADADTVRAVQEAAMK--GLSFGAPT 89 Query: 81 EPVLRLAKKLIDATFA-DRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNAFH 139 E + LA+ L+ + + V +SG EA +A++LAR F + + I+ F+ +H Sbjct: 90 EAEIELAELLVRRVPSMEMVRLVSSGTEATMSAIRLARGF------TGRDAIIKFEGCYH 143 Query: 140 GR--TLFTVSAGGQPAYSQ-DFAPLPADI-RHAAYNDINSASALID------DSTCAVIV 189 G +L + G + A +PAD+ +H D N A L D + VIV Sbjct: 144 GHGDSLLVKAGSGLLTFGNPSSAGVPADLAQHTLVLDYNDAQGLRDAFAKHGKTIACVIV 203 Query: 190 EPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLT 249 EP+ G ++ FL +RELC +H ++LIFDEV TG R G A YG+TPDL T Sbjct: 204 EPVAGNMNLIAPKPEFLAAMRELCTQHGSVLIFDEVMTGF-RVGPGSAQGLYGITPDLST 262 Query: 250 TAKALGGGFPVGALLATEE-CARVMTVGT--HGTTYGGNPLASAVAGKVLELINTPEMLN 306 K +GGG P+GA + ++ +G T GNPL+ A L+ + P + Sbjct: 263 FGKVVGGGMPLGAFGGRRDIMEKIAPLGPVYQAGTLSGNPLSVAAGLVTLKKVGAPGFYD 322 Query: 307 GVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIG 340 + + V+ L + G+ + +G + G Sbjct: 323 ALTAKTRTLVDGLAAAAKKRGVKFSAQSVGGMFG 356 Lambda K H 0.319 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 405 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 425 Length adjustment: 31 Effective length of query: 375 Effective length of database: 394 Effective search space: 147750 Effective search space used: 147750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory