Align IGP synthase, amidotransferase subunit (EC 4.3.2.10) (characterized)
to candidate WP_041100147.1 SUTH_RS14140 imidazole glycerol phosphate synthase subunit HisH
Query= reanno::HerbieS:HSERO_RS20325 (212 letters) >NCBI__GCF_000828635.1:WP_041100147.1 Length = 212 Score = 272 bits (696), Expect = 3e-78 Identities = 131/212 (61%), Positives = 153/212 (72%) Query: 1 MNKIVVVDYGMGNLRSVAQALRHVAPEADVRISGEVADIRAADRVVLPGQGAMPDCMRSL 60 M+ +VVVDYGMGNLRSVA+A+ HVAPEA+VR+S + A+I AADRVV+PGQGAMPDCMR L Sbjct: 1 MSTVVVVDYGMGNLRSVAKAIEHVAPEAEVRVSSDAAEIAAADRVVVPGQGAMPDCMREL 60 Query: 61 RESGVQDAVIEASRTKPLFGVCVGEQMLFDWSEEGDTPGLGLLPGKVVRFDLEGMRQDDG 120 G+++AV+ A+ KP G+CVG QMLF +EEGD GL +LPG+V RF E M DG Sbjct: 61 SARGLREAVVRAAAEKPFLGICVGLQMLFGHAEEGDVMGLEILPGRVPRFPGEAMAAPDG 120 Query: 121 SLFKVPQMGWNHVHQTSRHPLWEGIADNAFFYFVHSYYAVPAESAHVVGQTPYGRDFACA 180 S KVP MGWN V Q HPLW+GI D A FYFVHSYY P + G T YG F A Sbjct: 121 SRLKVPHMGWNQVQQVEAHPLWDGIEDGARFYFVHSYYVEPQSPEVIAGSTHYGIPFTSA 180 Query: 181 VARDNIFATQFHPEKSASAGLQLYRNFVHWKP 212 VAR NIFA QFHPEKSA AGL+L NF+ W P Sbjct: 181 VARANIFAVQFHPEKSAQAGLRLLGNFMRWNP 212 Lambda K H 0.322 0.137 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 212 Length adjustment: 21 Effective length of query: 191 Effective length of database: 191 Effective search space: 36481 Effective search space used: 36481 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate WP_041100147.1 SUTH_RS14140 (imidazole glycerol phosphate synthase subunit HisH)
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))
../bin/blast/fastacmd -i /tmp/list.680.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.680.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.