Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_041100371.1 SUTH_RS14945 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_000828635.1:WP_041100371.1 Length = 386 Score = 175 bits (443), Expect = 2e-48 Identities = 115/360 (31%), Positives = 183/360 (50%), Gaps = 10/360 (2%) Query: 26 QHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYMKKKADFN 85 Q + L +G+PDF T + AA++ + YT G LR+A+ + + + Sbjct: 28 QGRTITHLEVGEPDFATAAPILEAAQRFLSGGHVHYTAALGLPRLREAISGFYHTRHGLD 87 Query: 86 YDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPV-IVDTTS 144 E I++T GAS A+ A +++PGDE ++P P YP + L KPV + + Sbjct: 88 IPPE-RIVVTAGASGALLLALGVLVNPGDEWLLPDPGYPCNRHFVRLLEGKPVSLAVEAA 146 Query: 145 HGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNVFVLSDEIYS 204 ++ TA + ++ TP T+ +++ P+NPTG L E + S+A + R +L DEIY Sbjct: 147 SNYQPTAAQLAESWTPRTRGLLVASPANPTGALLDPETMASLANGVATRGGSLLVDEIYH 206 Query: 205 ELTYDRPHYSIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQYNVSCA 264 LTY S A + D VIN SK MTGWR+G+L AP+ + I K+ Q Sbjct: 207 GLTYGIDATS-ALSVSDDAFVINSFSKYFGMTGWRLGWLVAPQRFVREIEKLAQNLYIAP 265 Query: 265 SSISQKAALEAV---TNGFDDALIMREQYKKRLDYVYDRLVSMGLDV-VKPSGAFYIFPS 320 S+++Q AAL A T +A R+++ R D + L ++G ++ +P GAFY++ + Sbjct: 266 STVAQHAALAAFHPETTAILEA--RRQEFSSRRDILLPGLRTLGFEIAAEPQGAFYVYAN 323 Query: 321 IKSFGMTSFDFSMALLEDAGVALVPGSSF-STYGEGYVRLSFACSMDTLREGLDRLELFV 379 SF + LL AGVA PG F S + ++R ++ + EGLDR+ F+ Sbjct: 324 SSRLAEDSFTLAEQLLTQAGVAATPGLDFGSNAPQSHMRFAYTVGRGRIEEGLDRMATFL 383 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 386 Length adjustment: 30 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory