Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_041100201.1 SUTH_RS14340 aminodeoxychorismate/anthranilate synthase component II
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000828635.1:WP_041100201.1 Length = 188 Score = 283 bits (724), Expect = 1e-81 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 5/191 (2%) Query: 1 MLLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAG 60 MLLMIDNYDSFTYNLVQYFGEL +VKV RND +++++I A+ P RIV+SPGPC+P EAG Sbjct: 1 MLLMIDNYDSFTYNLVQYFGELGEDVKVFRNDAITLKEIAAMKPARIVVSPGPCSPAEAG 60 Query: 61 VSLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLAN 120 +S+A I+ FAGK+PLLGVCLGHQSIG AFGGE+V A+Q+MHGKTSP+ H GVFAGL N Sbjct: 61 ISVAAIKEFAGKIPLLGVCLGHQSIGAAFGGEIVHAKQLMHGKTSPVTHSGKGVFAGLPN 120 Query: 121 PLTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTE 180 PLTV RYHSL ++RE+LP CLE+TAWT+ DG EIMGVRHK +VEGVQFHPESI TE Sbjct: 121 PLTVVRYHSLAIRRETLPACLEITAWTE--DG---EIMGVRHKEFDVEGVQFHPESIQTE 175 Query: 181 QGHELLANFLR 191 GH+LL NFL+ Sbjct: 176 SGHDLLKNFLQ 186 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 188 Length adjustment: 20 Effective length of query: 181 Effective length of database: 168 Effective search space: 30408 Effective search space used: 30408 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 44 (21.6 bits)
Align candidate WP_041100201.1 SUTH_RS14340 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.7408.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.7408.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.