Align Arogenate dehydratase 2; PhADT2; Prephenate dehydratase ADT3; EC 4.2.1.91; EC 4.2.1.51 (characterized)
to candidate WP_014148952.1 MEALZ_RS12220 prephenate dehydratase
Query= SwissProt::D3U716 (394 letters) >NCBI__GCF_000968535.2:WP_014148952.1 Length = 361 Score = 145 bits (367), Expect = 1e-39 Identities = 100/285 (35%), Positives = 146/285 (51%), Gaps = 22/285 (7%) Query: 107 LRVAYQGVRGAYSESAAEKAYPNC-EAVPCEQFDTAFEAVERWLVDRAVLPIENSLGGSI 165 L VA+ G G +++ AA K + + AVP F AVE V+P+ENS G + Sbjct: 92 LDVAFLGPEGTFTQQAAIKHFGHAVNAVPAMTIAEIFNAVENEHCQFGVVPVENSTEGVV 151 Query: 166 HRNYDLLLRHRLHIVGEVKLAIRHCLLANNGVKIEDLKRVLSHPQALAQCEN--NLTKLG 223 + D + L I GEV+L + H L+ N G + D+ V SH Q+LAQC +L Sbjct: 152 NHTLDRFVSSPLKICGEVELRVHHNLIGNAG-SLADIAEVFSHQQSLAQCRQWLDLHLPD 210 Query: 224 LVREAVDDTAGAAKYIAFQQLKDAGAVASLAAARIYGLNVLAQDIQDDSDNVTRFLMLAR 283 R AV+ AA+ A KD A+A AA +YGL+V+ ++I+D+S+N TRF+++ R Sbjct: 211 AKRTAVNSNGEAARLAAGS--KDKAAIAGKFAAELYGLSVIERNIEDESNNTTRFIIIGR 268 Query: 284 EPIIPGTDKPFKTSVVFSLDEGPGVLFKALAVFAMRNINLTKIESRPLQKQALRVLDDSA 343 + I G KTS++ S PG L++ L FA I + IESRP +Q L Sbjct: 269 Q--ISGPTGKDKTSLLVSTGNQPGALYRVLEPFAHHGIGMMHIESRP-SRQGL------- 318 Query: 344 DGFPKYFPYLFYVDFEASMADQRAQNALGHLKEFATFLRVLGSYP 388 + Y+F++D E D+ AL L + L +LGSYP Sbjct: 319 ------WDYVFFIDIEGHAEDENVAAALKMLGARVSMLNILGSYP 357 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 361 Length adjustment: 30 Effective length of query: 364 Effective length of database: 331 Effective search space: 120484 Effective search space used: 120484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory