Align Succinylornithine transaminase; SOAT; Succinylornithine aminotransferase; EC 2.6.1.81 (characterized)
to candidate WP_050461046.1 AKL27_RS02370 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q8ZPV2 (408 letters) >NCBI__GCF_001189915.1:WP_050461046.1 Length = 422 Score = 211 bits (538), Expect = 2e-59 Identities = 142/396 (35%), Positives = 196/396 (49%), Gaps = 37/396 (9%) Query: 17 VYVPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPALREALNEQANRFWHIGN 76 V V F R E S LWD +G+ YIDFA GIAV GH HP L A+ +Q + F H Sbjct: 18 VGVMCDFYAARAENSELWDVEGRRYIDFAAGIAVLNTGHRHPKLVAAIKQQLDHFTH--T 75 Query: 77 GYTNEPA---LRLAKK---LIDATFAERVFFCNSGAEANEAALKLARKYAHDRVGNHKSG 130 Y P + LA++ L F ++ ++GAEA E A+K+AR ++ Sbjct: 76 AYQIVPYASYVELAERINTLAPGAFPKKTALFSTGAEAVENAIKIAR------AATGRAA 129 Query: 131 IVAFKNAFHGRTLFTVSAGGQPT-YSQDFAPLPPDIRHAAY----------NDLNSASAL 179 ++AF FHGRT+ ++ G+ Y F P P D+ H + + L++ AL Sbjct: 130 VIAFSGGFHGRTMMGMALTGKVVPYKVGFGPFPGDVYHVPFPSALHDISTEDSLSAIQAL 189 Query: 180 IDDNT-----CAVIVEPVQGEGGVIPATKAFLQGLRELCDRHQALLIFDEVQTGVGRTGE 234 + A+I+EPVQGEGG A + GLR +CD H LLI DEVQTG RTG+ Sbjct: 190 FKSDVEAKRVAAIIIEPVQGEGGFQAAPPELMHGLRRICDEHGILLIADEVQTGFARTGK 249 Query: 235 LYAYMHYGVTPDILTTAKALGGGFPIGAMLTTQDYASVMTPGTHGTTYGGNPLATAVAGK 294 L+A HY V D++T AK+L GG P+ A+ + PG G TY GNPLA A A Sbjct: 250 LFAMEHYDVAADLITMAKSLAGGMPLSAVCGRTEIMDAPAPGGLGGTYAGNPLAVASALA 309 Query: 295 VLDIINTPEMQNGVRQRHDAFIERLNTLNVRFGMFSEIRGLGLLLGCVL----QTE-FAG 349 VLD+I ++ + D LN L EIRG G ++ TE A Sbjct: 310 VLDVIKEEQLVERGARLGDQLKATLNELRGSVPAIGEIRGPGAMVAVEFVKPGSTEPDAD 369 Query: 350 KAKLIAQEAAKAGVMVLIAG--GDVVRFAPALNVSD 383 K + A + G+++L G G+V+RF L + D Sbjct: 370 FTKRVQTLALQQGLLLLSCGTYGNVIRFLFPLTIQD 405 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 462 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 408 Length of database: 422 Length adjustment: 31 Effective length of query: 377 Effective length of database: 391 Effective search space: 147407 Effective search space used: 147407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory