Align Succinylornithine transaminase; SOAT; EC 2.6.1.81; Succinylornithine aminotransferase (uncharacterized)
to candidate WP_050463092.1 AKL27_RS12160 acetylornithine transaminase
Query= curated2:Q3Z295 (406 letters) >NCBI__GCF_001189915.1:WP_050463092.1 Length = 400 Score = 283 bits (724), Expect = 6e-81 Identities = 158/363 (43%), Positives = 216/363 (59%), Gaps = 7/363 (1%) Query: 29 EGSRLW--DQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGNGYTNEPVLRL 86 EGS +W D GK Y+D+ G AVNALGH+ + +AL QA K + + N P + L Sbjct: 24 EGSGMWMTDHTGKRYLDYLQGWAVNALGHSPQCMVDALTAQAKKLINPSPAFYNAPSIEL 83 Query: 87 AKKLIDATFADRVFFCNSGAEANEAALKLARKFAH---DRYGSHKSGIVAFKNAFHGRTL 143 A L + + DRVFF NSGAEANE A+KLARK+ D G + I+ F ++FHGRT+ Sbjct: 84 ADLLTENSVFDRVFFANSGAEANEGAIKLARKWGKKNPDSEGQDRFEIITFDHSFHGRTI 143 Query: 144 FTVSAGGQPAYSQDFAPLPPDIRHAAYNDINSASALIDDATCAVIVEPIQGEGGVVPASN 203 T+SA G+P + FAP P + A ND+ S LI T AV++EP+QGEGGV+PA+ Sbjct: 144 ATMSASGKPGWDTMFAPQVPGFKKAELNDLTSVERLITKKTVAVMLEPVQGEGGVIPATR 203 Query: 204 AFLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHYGVTPDLLTTAKALGGGFPVGAL 263 F+QGLR L + N LLI DEVQTG GRTGEL+AY + PD++T K +GGG P+ AL Sbjct: 204 EFMQGLRRLTKQANLLLIVDEVQTGFGRTGELFAYQLSDIEPDIMTLGKGIGGGVPLAAL 263 Query: 264 LTTEECASVMTVGTHGTTYGGNPLASAVAGKVLELINTPEMLNGVKQRHDWFVERLNTIN 323 L EE A G G TY GNPL +AV VL+ + P L VK + + L ++ Sbjct: 264 LAREEIA-CFEAGEQGGTYNGNPLMTAVGAAVLKELLKPGFLQSVKDQGQYLSSELIKLS 322 Query: 324 HRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQEAAKAGVMVLIAGGNVVRFAPALNVSE 383 ++G F RG GLL L D Q + +++ G+++ N++RF P+LNVS+ Sbjct: 323 DKHG-FEGERGEGLLRALKLGKDIGPQIVEAARDLNPIGLLINSPRPNLLRFMPSLNVSK 381 Query: 384 EEV 386 +E+ Sbjct: 382 DEI 384 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 400 Length adjustment: 31 Effective length of query: 375 Effective length of database: 369 Effective search space: 138375 Effective search space used: 138375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory