Align N-acetylornithine carbamoyltransferase (EC 2.1.3.9) (characterized)
to candidate WP_050461231.1 AKL27_RS02880 ornithine carbamoyltransferase
Query= BRENDA::Q8P8J2 (339 letters) >NCBI__GCF_001189915.1:WP_050461231.1 Length = 304 Score = 113 bits (282), Expect = 7e-30 Identities = 104/341 (30%), Positives = 154/341 (45%), Gaps = 49/341 (14%) Query: 1 MSLKHFLNTQDWSRAELDALLTQAALFKRNKLGSE----LKGKSIALVFFNPSMRTRTSF 56 M++KH+L D++ E + ++ + + KR E L +++ +VF S RTR SF Sbjct: 1 MAIKHYLQFSDFTLDEYEHVIERTRVIKRKFKNYEPYHPLADRTLVMVFEKNSTRTRLSF 60 Query: 57 ELGAFQLGGHAVVLQPGKDAWPIEFNLGTVMDGDTEEHIAEVARVLGRYVDLIGVRAFPK 116 E G QLGG A+ L + LG E I + A+V+ R D+I +R F + Sbjct: 61 EAGMHQLGGAAIYLNTR------DSQLGR------GEPIEDAAQVMSRMCDVIMIRTFGQ 108 Query: 117 FVDWSKDREDQVLKSFAKYSPVPVIN-METITHPCQELAHALALQEHFGTPDLRGKKYVL 175 +++ FA YS VPVIN + HPCQ LA E G+ ++GK + Sbjct: 109 ----------EIIDRFAAYSRVPVINGLTNEHHPCQVLADVFTYIEQRGS--IQGK--TV 154 Query: 176 TWTYHPKPLNTAVANSALTIATRMGMDVTLLCPTPDYILDERYMDWAAQNVAESGGSLQV 235 W + S L A G V + P Y +D Q V+ V Sbjct: 155 AWIGDANNM----LYSWLQAAEVFGFHVNVSTPK-GYDIDP-------QLVSPRNQRYTV 202 Query: 236 SHDIDSAYAGADVVYAKSWGALPFFGNWEPEKPIR-DQYQHFIVDERKMALTN-NGVFSH 293 + A G D+V W ++ +E E R + +IVD KMA + +F H Sbjct: 203 FANPGDACDGVDLVTTDVWTSM----GYEDENAARLKAFDGWIVDSAKMARAKADALFMH 258 Query: 294 CLPLRRNVKATDAVMDSPNCIAIDEAENRLHVQKAIMAALV 334 CLP R + + V+D P + +EAENRLHVQKA++ LV Sbjct: 259 CLPAHRGEEVSAEVIDGPQSVVWNEAENRLHVQKALLEYLV 299 Lambda K H 0.320 0.134 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 304 Length adjustment: 28 Effective length of query: 311 Effective length of database: 276 Effective search space: 85836 Effective search space used: 85836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory