Align homoserine kinase (EC 2.7.1.39) (characterized)
to candidate WP_050464609.1 AKL27_RS19905 bifunctional shikimate kinase/3-dehydroquinate synthase AroKB
Query= metacyc::MONOMER-21144 (185 letters) >NCBI__GCF_001189915.1:WP_050464609.1 Length = 561 Score = 84.0 bits (206), Expect = 4e-21 Identities = 52/147 (35%), Positives = 79/147 (53%), Gaps = 3/147 (2%) Query: 19 GCVSIIGMAGAGKTTVGRELALQLGWAHVDTDNLIEATYGTRLQAVADSMDKESFLDVEA 78 G + ++G+ GAGKTT+GR LA +L +D+D+ IEA GT + + + +ESF EA Sbjct: 3 GSIFLVGLMGAGKTTIGRALAKKLNKRFIDSDHEIEARTGTTIPVIFEIEGEESFRKREA 62 Query: 79 GVIRRIGA-RRTVLSTGGSVVYRHEAMAHLAALGPLVYLDVSLPLILKRIAMNPDRGL-- 135 +IR + A VL+TGG + E L G ++YL + IL+R + +R L Sbjct: 63 EIIRELSALPDVVLATGGGAILHPETRTCLKNRGTVIYLRAGINQILQRTGRDKNRPLLQ 122 Query: 136 AIAPGQTIEDLYNERIALYRRYATFTV 162 P + +E+L +R YR A F V Sbjct: 123 TADPRRKLEELSRQRDPYYREVAHFIV 149 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 185 Length of database: 561 Length adjustment: 27 Effective length of query: 158 Effective length of database: 534 Effective search space: 84372 Effective search space used: 84372 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory