Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_053767952.1 BVI061214_RS08055 ornithine carbamoyltransferase
Query= BRENDA::Q5SJ15 (301 letters) >NCBI__GCF_001280255.1:WP_053767952.1 Length = 301 Score = 532 bits (1370), Expect = e-156 Identities = 266/301 (88%), Positives = 277/301 (92%) Query: 1 MGGEALTLPKDLLDFSGYGPKELQALLDLAEQLKRERYRGEDLKGKVLALLFEKPSLRTR 60 MGGE LTLPKDLLDFSGY + L+ LLDLAE LKRERYRGEDLKGK LALLFEKPSLRTR Sbjct: 1 MGGETLTLPKDLLDFSGYTKEALKRLLDLAEALKRERYRGEDLKGKSLALLFEKPSLRTR 60 Query: 61 TTLEVAMVHLGGHAVYLDQKQVGIGEREPVRDVAKNLERFVEGIAARVFRHETVEALARH 120 TTLEVAMVHLGGHA+YLDQKQVGIGEREPVRD+AKNLERFVEGIAARV+RH TVE LARH Sbjct: 61 TTLEVAMVHLGGHALYLDQKQVGIGEREPVRDIAKNLERFVEGIAARVYRHRTVEELARH 120 Query: 121 AKVPVVNALSDRAHPLQALADLLTLKEVFGGLAGLEVAWVGDGNNVLNSLLEVAPLAGLK 180 A++PV+NALSDRAHPLQALADLLTLKE FGGL GLEVAWVGDGNNVL SLLEVAPL GLK Sbjct: 121 ARIPVINALSDRAHPLQALADLLTLKEAFGGLEGLEVAWVGDGNNVLASLLEVAPLVGLK 180 Query: 181 VRVATPKGYEPDPGLLKRANAFFTHDPKEAALGAHALYTDVWTSMGQEAEREKRLRDFQG 240 VRVATP+GYEP+ LL RA AF THDPKEA LGAHALYTDVWTSMGQEAEREKRLRDFQG Sbjct: 181 VRVATPRGYEPEAALLARAGAFLTHDPKEAVLGAHALYTDVWTSMGQEAEREKRLRDFQG 240 Query: 241 FQVNGELLKLLRPEGVFLHCLPAHYGEETTEEAVHGPRSRVFDQAENRLHTAKAVLLTLL 300 FQ NG LL LL PEG+FLHCLPAHYGEETTEEAV GPRSRVFDQAENRLHTAKAVLLTLL Sbjct: 241 FQANGPLLDLLHPEGIFLHCLPAHYGEETTEEAVFGPRSRVFDQAENRLHTAKAVLLTLL 300 Query: 301 K 301 K Sbjct: 301 K 301 Lambda K H 0.319 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 444 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 301 Length adjustment: 27 Effective length of query: 274 Effective length of database: 274 Effective search space: 75076 Effective search space used: 75076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_053767952.1 BVI061214_RS08055 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.3411131.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-110 353.0 0.0 7.7e-110 352.8 0.0 1.1 1 NCBI__GCF_001280255.1:WP_053767952.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001280255.1:WP_053767952.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 352.8 0.0 7.7e-110 7.7e-110 1 303 [. 10 300 .. 10 301 .] 0.98 Alignments for each domain: == domain 1 score: 352.8 bits; conditional E-value: 7.7e-110 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkgktlaliFekrstRtRvsfevaayelGaqvlylnk 73 ++ll++ +++e lk+ll+la+ lk+e+++ + lkgk+lal+Fek+s RtR ++eva+++lG+++lyl++ NCBI__GCF_001280255.1:WP_053767952.1 10 KDLLDFSGYTKEALKRLLDLAEALKRERYR---GEDLKGKSLALLFEKPSLRTRTTLEVAMVHLGGHALYLDQ 79 799**************************9...589************************************* PP TIGR00658 74 eelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDlltikeklgkl 146 +++ +g++e+++D a+ l+r+v++i++Rvy+h++veela++a +Pvin+L+d +hP+q+laDllt+ke +g l NCBI__GCF_001280255.1:WP_053767952.1 80 KQVGIGEREPVRDIAKNLERFVEGIAARVYRHRTVEELARHARIPVINALSDRAHPLQALADLLTLKEAFGGL 152 ************************************************************************* PP TIGR00658 147 kevklvyvGDannvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkleltedpkkavkdadv 219 +++++++vGD+nnv sll a ++Gl+v+vatP+g+epea+++ +a + lt+dpk+av +a+ NCBI__GCF_001280255.1:WP_053767952.1 153 EGLEVAWVGDGNNVLASLLEVAPLVGLKVRVATPRGYEPEAALLARAGA---------FLTHDPKEAVLGAHA 216 *******************************************999954.........59************* PP TIGR00658 220 iytDvwvsmGeeekkeerlkllkpyqvneellelakpevkflhCLPavrGeevtdevlegeasivfdeaenRl 292 +ytDvw+smG+e+++e+rl+ ++++q n ll+l +pe +flhCLPa+ Gee+t+e + g++s+vfd+aenRl NCBI__GCF_001280255.1:WP_053767952.1 217 LYTDVWTSMGQEAEREKRLRDFQGFQANGPLLDLLHPEGIFLHCLPAHYGEETTEEAVFGPRSRVFDQAENRL 289 ************************************************************************* PP TIGR00658 293 haqkavlkall 303 h++kavl +ll NCBI__GCF_001280255.1:WP_053767952.1 290 HTAKAVLLTLL 300 *******9887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (301 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 14.82 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory