Align Probable aspartate/prephenate aminotransferase; AspAT / PAT; EC 2.6.1.1; EC 2.6.1.78; Transaminase A (uncharacterized)
to candidate WP_053767116.1 BVI061214_RS02250 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= curated2:O33822 (383 letters) >NCBI__GCF_001280255.1:WP_053767116.1 Length = 356 Score = 127 bits (319), Expect = 5e-34 Identities = 115/356 (32%), Positives = 169/356 (47%), Gaps = 23/356 (6%) Query: 32 DLVALTAGEPDFDTPEHVKEAGRRALAQGKTKYAPPAGIPELREAVAEKFRRENGLEVTP 91 D++ L + DF E ++ A +A A+G Y P G EL+ + E+ + + P Sbjct: 18 DVLPLWVADMDFPVAEPIRRA-IQARAEGFLGYPPREGDKELKALLLERTGLQGEVAFMP 76 Query: 92 EETIVTVGGKQALFNLFQAILDPGDEVIVLAPYWVSYPEMVRFAGGVPVEVPTLPEE-GF 150 V VG L+ A PG V+ P + + +R G + P E G+ Sbjct: 77 G---VVVG----LYAAVAAFTAPGHGVLTQVPVYPPFLSAIREQGRTLLANPLKETEAGY 129 Query: 151 VPDPERVRRAITPRTKALVVNSPNNPTGVVYPEEVLRALAEMALQHDFYLVSDEIYEHLI 210 D + R + ++ L+ P NPTG V+ EE L ALA++A +HD +VSDE++ L Sbjct: 130 RLDLGGLER-LAYASRLLLFCHPQNPTGRVFTEEELSALAQVARKHDLVVVSDELHAPLT 188 Query: 211 YEGAHFSPGTLAPEHTITVNGAAKAFAMTGWRIGYACGPKAVIKAMADVSSQSTTSPDTI 270 YE H PE TIT+ G KA+ + G +G A GPK +++A+ T P+ + Sbjct: 189 YERPHIPLARFLPERTITLLGPGKAYNLAGLPMGAAVGPKPLVEALK--RHLPHTFPNVL 246 Query: 271 AQWATLEALTNREASMAFIAMAREAYRKRRDLLLEGLSRIGLEAVRPSGAFYVLMDTSPF 330 A A AL E ++ R+ RD L +GL V P G Y+ PF Sbjct: 247 AMAAWKAALLEGE---GWLREVLGMLRQNRDRLAAWAQEMGLFHVPPEGT-YLAWLRMPF 302 Query: 331 APNEVEAAERLL-MAGVAVVPGTEFAA--FGHVRLSYATGEENLKKALERFAQALQ 383 +AA RLL A VA+ PG F +VRL++AT E L++AL R AQAL+ Sbjct: 303 P----KAASRLLEEARVALNPGENFGKGYDRYVRLNFATYPEVLEEALSRMAQALK 354 Lambda K H 0.317 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 356 Length adjustment: 30 Effective length of query: 353 Effective length of database: 326 Effective search space: 115078 Effective search space used: 115078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory