Align Aspartate aminotransferase; AspAT; EC 2.6.1.1; Transaminase A (uncharacterized)
to candidate WP_055067282.1 M72_RS04030 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= curated2:Q9V0L2 (389 letters) >NCBI__GCF_001406815.1:WP_055067282.1 Length = 390 Score = 355 bits (911), Expect = e-102 Identities = 186/383 (48%), Positives = 252/383 (65%), Gaps = 3/383 (0%) Query: 3 MSDRLDLVNPSEIRKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDMGLTHYGPN 62 +S + + PS IRK FDI + M D ISLG+GEPDFDTP HI++ +L+ G T Y N Sbjct: 5 LSKTITTIEPSGIRKFFDIVSEMDDAISLGVGEPDFDTPWHIRDEGIYSLEKGRTFYTSN 64 Query: 63 IGLPELREAIAEKLKKQNNIEADPNKEIMVLVGANQAFLMGLSAFLKDGEEVLIPTPAFV 122 GL EL+ I+ L ++ + D NKE++V VG ++A + + A L +EVLIP P++V Sbjct: 65 AGLKELKIEISRYLDRRFGLSYDYNKEMLVTVGGSEAIDIAMRAMLDPQDEVLIPQPSYV 124 Query: 123 SYAPAVILAGGKPVEVPTYEENEFRLNVDELKKYVTEKTKALIINSPCNPTGSVLKKKDL 182 SY P +LA G PV + ENEFRL +EL+ +T KTK L++ P NPTG+V++KKDL Sbjct: 125 SYVPCCVLANGTPVPIELKAENEFRLTAEELEAAITPKTKLLVMPFPNNPTGAVMEKKDL 184 Query: 183 EEIADFAVEHDLIVISDEVYEHFIYDDVKHYSIASLDGMFERTITVNGFSKTFAMTGWRL 242 E +A+ +HDL V+SDE+Y Y D H SIAS+ GM ERTI +NGFSK+ AMTGWRL Sbjct: 185 EAVAEVVKKHDLFVLSDEIYAELTYLD-NHVSIASIPGMRERTIVINGFSKSHAMTGWRL 243 Query: 243 GFVAAPSWIIEKMVKFQMYNATCPVTFIQYAAAKALRDERSWKAVEEMRKEYDRRRKLVW 302 G+ P II++M+K + C T QYAA +ALR+ + V MR+EY+ RR+ V Sbjct: 244 GYACGPEVIIKQMLKIHQFAIMCAPTTSQYAAVEALRN--GDEDVAMMREEYNGRRRYVL 301 Query: 303 KRLNEMGLPTVKPKGAFYIFPRIKDTGLTSKEFSELMLMEAKVAVVPGSAFGKAGEGYVR 362 +R EMGL +P GAFY FP IKD G+TS EF+ +L KVAVVPG+AFG GEG++R Sbjct: 302 ERFKEMGLSCFEPFGAFYAFPCIKDLGMTSDEFATKLLQTKKVAVVPGTAFGACGEGFLR 361 Query: 363 ISYATAYEKLEEAMDRMEKVLRE 385 ISYA + + L A+DR+ + + E Sbjct: 362 ISYAYSLDDLRIALDRVAEFVTE 384 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 389 Length of database: 390 Length adjustment: 30 Effective length of query: 359 Effective length of database: 360 Effective search space: 129240 Effective search space used: 129240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory