Align Predicted argE by GapMind curators (no experimental data)
to candidate WP_057509267.1 ABB28_RS14300 M20 family metallopeptidase
Query= predicted:W3Y6L2 (394 letters) >NCBI__GCF_001431535.1:WP_057509267.1 Length = 439 Score = 255 bits (651), Expect = 2e-72 Identities = 153/401 (38%), Positives = 217/401 (54%), Gaps = 22/401 (5%) Query: 12 ASQYKEQVVAWRRHIHSHPELSGEEKETSAFIQSVLTDLGIPFKADVYKYAVIGEIKGAF 71 A + + QVV WRR H HPELS E+ TSA + L +G+ K + + V+ I+G Sbjct: 33 AQRLQAQVVEWRRDFHQHPELSNREERTSAEVAKRLRAMGLKPKTGIAHHGVVAIIEGGK 92 Query: 72 DGPVVGLRADMDALPITEVTGLPFTS--------ENPGVMHACGHDSHMAILLGAAAILQ 123 GP + LRADMDALP+TE TGLPF S + GVMHACGHD+H A LLG A L Sbjct: 93 PGPKIALRADMDALPVTEQTGLPFASKATSTYRGQQVGVMHACGHDAHTATLLGVAEALV 152 Query: 124 SVKDQLHGTVKLVIQPAEEEALIK---GAQGIVDSGVLDDV--DEIYGLHVWPQLPVGTV 178 +++ L G V L+ QPAEE A GA ++ GV D + ++GLHV+ + G + Sbjct: 153 AMRKDLPGQVMLIFQPAEEGAPSPEEGGAALMLKEGVFADFKPEAVFGLHVFSSVQAGKI 212 Query: 179 GLKKGNLMAASDRFLVHIKGKATHGAEPHNGIDAIVAAANWIVNVESMVARETN-PMDNL 237 ++ G LMAASDRF + + G+ THG+ P NG+D IVA A+ I +++V+R TN Sbjct: 213 AVRGGPLMAASDRFGIKVIGRQTHGSAPWNGVDPIVATADLIGTAQTIVSRRTNLAQQPA 272 Query: 238 VCTIGVFNSGDRYNVGSGDAYLEGTCRTYDPAKRDYIERRLGESLKALDMMFGTTSTLEY 297 V T G N G RYN+ + + GT RT+D R I L + G T+ E Sbjct: 273 VVTFGAINGGIRYNIIPDEVEMVGTIRTFDEGMRQQIFADLRNVAEHTTAAHGATAVTEI 332 Query: 298 --RRGHGATINDADAIDYVTHIVKTYLGKDAVVHPEFPSMAAEDFSAYLNKIKGAFLWLG 355 G+ AT+ND + ++ +GKD V P M AEDFS + ++ G F ++G Sbjct: 333 YEAEGNPATVNDPQLTARMLPSLQAVVGKDNVYEPPL-QMGAEDFSLFAREVPGMFFFVG 391 Query: 356 TGFEG-----NPALHNAAFTIDESILEPGITMMAGIAAELL 391 + EG PA H+ F +DE L+ G+ + ++ + L Sbjct: 392 STSEGIDPAKAPANHSPKFLLDEKALDVGLRALLQVSLDYL 432 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 18 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 439 Length adjustment: 31 Effective length of query: 363 Effective length of database: 408 Effective search space: 148104 Effective search space used: 148104 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory