Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_058931706.1 AU252_RS16745 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_001484605.1:WP_058931706.1 Length = 405 Score = 311 bits (798), Expect = 2e-89 Identities = 160/392 (40%), Positives = 244/392 (62%), Gaps = 5/392 (1%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGET-K 73 + RIS+I S L + A+A A+K G+PVI GAGEPDF TP+++ +A+ +A + + + Sbjct: 7 SQRISAIAESATLAVDAKAKALKAAGRPVIGFGAGEPDFPTPDYIVKASIEAASQPKYHR 66 Query: 74 YTALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTP 133 Y+ G PELKKAI EK R++G A + ++ V G KQ ++N +DPGDEVI+PTP Sbjct: 67 YSPAAGLPELKKAIAEKTLRDSGYAVDPSQVLVTNGGKQAVYNTFATLVDPGDEVIVPTP 126 Query: 134 YWTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSA 193 +WT+Y + + + G PV + + +T E+LEAA+T +++ +L SPSNP+G+ YS Sbjct: 127 FWTTYPEAIRLAGGVPVEVFAGPEQDYLVTVEQLEAAVTDKSKILLFVSPSNPTGSVYSP 186 Query: 194 ADYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAM 253 + + +W++ D++YEH+ YDG F + A P L ++ + +NGV+K YAM Sbjct: 187 EQVAEIGKWAAAKG-LWVVTDEIYEHLTYDGVPFTSIATAAPELGDKVVILNGVAKTYAM 245 Query: 254 TGWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRD 313 TGWR+G+ GP ++IKA +QS ATS S+I Q A++AA++GP + E +F RRR Sbjct: 246 TGWRVGWMIGPADVIKAATNLQSHATSNVSNIMQIAALAAVSGPLTAVDEMKVAFDRRRK 305 Query: 314 LVVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRI---KTDTDFCAYLLEDAHV 370 +V GLNAIDG++C P+GAFY ++ +LGK P+ T + A +L + V Sbjct: 306 AIVAGLNAIDGVECPTPKGAFYVYADVRALLGKEFPTAAGTATPSTSAELAALILNEVEV 365 Query: 371 AVVPGSAFGLSPFFRISYATSEAELKEALERI 402 AVVPG AFG S + R+SYA + +L + R+ Sbjct: 366 AVVPGEAFGPSGYLRLSYALGDEDLATGVARL 397 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 405 Length adjustment: 31 Effective length of query: 379 Effective length of database: 374 Effective search space: 141746 Effective search space used: 141746 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory