Align Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 (uncharacterized)
to candidate WP_066918605.1 ACG33_RS03090 glutamate-1-semialdehyde 2,1-aminomutase
Query= curated2:Q9CNT1 (398 letters) >NCBI__GCF_001579945.1:WP_066918605.1 Length = 424 Score = 135 bits (340), Expect = 2e-36 Identities = 97/316 (30%), Positives = 151/316 (47%), Gaps = 23/316 (7%) Query: 26 RGKGSHVWDQQGKDYIDFTSGIAVNSLGHCADEIVDVLKQQSEKLWHSSNWFTSEPTLAL 85 R G+ + D+ G+ YID+ LGH E++ +++++ L S T T L Sbjct: 34 RAGGALIHDEHGRSYIDYVGSWGPMILGHAHPEVIRTVQERAA-LGLSFGAPTRIET-QL 91 Query: 86 ATKLVE-KTFAERVMFVNSGAEANEAALKLARRYAVDHFGYQKSKIIAFKQSFHGRTLFT 144 A K+ E E V V+SG EA +A++LAR Y + KI+ F +HG + Sbjct: 92 ARKIGELMPSIELVRMVSSGTEATMSAIRLARGYT------GRDKIVKFAGCYHGHSDSL 145 Query: 145 VSVGGQAKYSDGFGPKP-------ADIVHVPFNDLAAVQAVMDE---NTCAVIVEPIQGE 194 + G + G P A + + +ND A V+ V D +IVEP+ G Sbjct: 146 LVKAGSGALTFGVPTSPGVPKELAAQTLTLAYNDAAEVKQVFDAVGGQIACIIVEPVAGN 205 Query: 195 SGILPASQDFLQGLRELCDQHNALLIFDEVQTGVGRTGYLYAYMKYEVVPDILTSAKALG 254 +P + FL+ LR +CDQH ++LIFDEV TG R A Y + PD+ T K +G Sbjct: 206 MNCVPPAPGFLETLRSVCDQHGSVLIFDEVMTGF-RVALGGAQALYGIKPDLTTLGKIVG 264 Query: 255 NGFPIGAMLTTHEIAKSFA---PGVHGTTFGGNPLACAVAEKVIDIISAPPFLQKIQRTS 311 G P+GA +I + A P T GNP+A A K +++I P F ++ +T+ Sbjct: 265 GGMPVGAFGGRRDIMEQIAPLGPVYQAGTLSGNPVAMAAGLKTLELIGEPDFHTRLAQTT 324 Query: 312 EKFMQKLQEINQQCGL 327 + ++ L E + G+ Sbjct: 325 TQLVEGLAEAARDAGV 340 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 424 Length adjustment: 31 Effective length of query: 367 Effective length of database: 393 Effective search space: 144231 Effective search space used: 144231 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory