Align arogenate dehydratase (EC 4.2.1.91) (characterized)
to candidate WP_083536533.1 ACG33_RS07095 prephenate dehydratase
Query= BRENDA::O22241 (424 letters) >NCBI__GCF_001579945.1:WP_083536533.1 Length = 414 Score = 146 bits (368), Expect = 1e-39 Identities = 96/288 (33%), Positives = 150/288 (52%), Gaps = 22/288 (7%) Query: 125 LRVAYQGVPGAYSEAAAGKAYPNC-DAIPCDQFDVAFQAVELWIADRAVLPVENSLGGSI 183 L++A+ G G +S+ A K + + A+P + FQ V+ AD V+P+ENS G++ Sbjct: 143 LKIAFLGPEGTFSQQAVLKHFGHSVRALPLPAINEVFQEVQSGHADFGVVPIENSTEGTV 202 Query: 184 HRNYDLLLRHRLHIVGEVQIPVH-HCLLALPGVRTDCVSRVISHPQALAQTEHSLDVLTP 242 + D+ L I GEV++ + H + + G+ ++RV SH Q+LAQ LD P Sbjct: 203 NHTLDMFPSSPLKICGEVELRIQQHLMGRMSGLEN--IARVCSHQQSLAQCRQWLDEYLP 260 Query: 243 HAAREAFHDTAAAAEYISANDLHDTAAVASARAAELYNLQILADGIQDDPGNVTRFLMLA 302 +A R A AA A D TAA+A AAE+Y L IL I+D P N TRFL++ Sbjct: 261 NAERMPVASNAEAAR--RARDEDGTAAIAGQAAAEVYGLNILVPDIEDSPDNTTRFLVIG 318 Query: 303 REPIIPRTDRPFKTSIVFAAQEHKGTSVLFKVLSAFAFRDISLTKIESRPHHNRPLRVVG 362 R+ + KT+++ +A + + L ++L A DI++T+IESRP R Sbjct: 319 RK--LFSASGNDKTTLLVSAGDTQAPGALHQLLGPLARHDITMTRIESRPSRRR------ 370 Query: 363 DGSFGTSKNFEYMFYVDFEASMAEPRAQNALAEVQEYTSFLRVLGSYP 410 ++Y+F++D EP + AL E+++ S R+LGSYP Sbjct: 371 --------KWDYVFFIDVAGHADEPPLKQALEELRKQASLFRILGSYP 410 Lambda K H 0.318 0.131 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 414 Length adjustment: 32 Effective length of query: 392 Effective length of database: 382 Effective search space: 149744 Effective search space used: 149744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory