Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_083536533.1 ACG33_RS07095 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_001579945.1:WP_083536533.1 Length = 414 Score = 399 bits (1024), Expect = e-115 Identities = 205/364 (56%), Positives = 267/364 (73%), Gaps = 5/364 (1%) Query: 4 ADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLKH 63 AD L +R RID +D +I +L++ERARCAQ+V R K ++ A + FYRPEREA VL+ Sbjct: 54 ADGLDCIRERIDDIDCQIHELLNERARCAQQVGRSKRSAGLSAVD--FYRPEREAQVLRR 111 Query: 64 IMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKP 123 ++E NKGPL NEE+ RLFREIMS+CLA ++PL++A+LGPEGTFSQ A LKHFGHSV + P Sbjct: 112 VIERNKGPLRNEEVVRLFREIMSACLAQQEPLKIAFLGPEGTFSQQAVLKHFGHSVRALP 171 Query: 124 MAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVG 183 + AI+EVF+EV +G +FGVVP+ENSTEG VNHTLD F + ICGEVELRI HL+ G Sbjct: 172 LPAINEVFQEVQSGHADFGVVPIENSTEGTVNHTLDMFPSSPLKICGEVELRIQQHLM-G 230 Query: 184 ETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDM 243 + + I R+ SH QSLAQCR+WLD + PN ER+ V+SNA+AA+R + E +AAIAG Sbjct: 231 RMSGLENIARVCSHQQSLAQCRQWLDEYLPNAERMPVASNAEAARRARDEDGTAAIAGQA 290 Query: 244 AAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSM--RNKPGALHELLM 301 AA++YGL+ L IED P N+TRFL+IG + +G+DKT+++VS PGALH+LL Sbjct: 291 AAEVYGLNILVPDIEDSPDNTTRFLVIGRKLFSASGNDKTTLLVSAGDTQAPGALHQLLG 350 Query: 302 PFHSNGIDLTRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361 P + I +TRIE+RPSR KW YVFFID GH +P +K LE++ +A ++LGSYP Sbjct: 351 PLARHDITMTRIESRPSRRRKWDYVFFIDVAGHADEPPLKQALEELRKQASLFRILGSYP 410 Query: 362 KAVL 365 AVL Sbjct: 411 CAVL 414 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 418 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 414 Length adjustment: 30 Effective length of query: 335 Effective length of database: 384 Effective search space: 128640 Effective search space used: 128640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory