Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate WP_066918605.1 ACG33_RS03090 glutamate-1-semialdehyde 2,1-aminomutase
Query= SwissProt::Q5JEW1 (445 letters) >NCBI__GCF_001579945.1:WP_066918605.1 Length = 424 Score = 120 bits (302), Expect = 6e-32 Identities = 94/314 (29%), Positives = 142/314 (45%), Gaps = 39/314 (12%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 PI IER G ++D G + D+ G + +GH+HP V+ ++++A + Sbjct: 29 PIFIERAGGALIHDEHGRSYIDYVGSWGPMILGHAHPEVIRTVQERAALGLSFGAPTRIE 88 Query: 97 ENAIILAEKLIELAPG-DIERKVVYGNSGAEANEAAMKLVKYGTGRKQFLAFYHAFHGRT 155 LA K+ EL P ++ R V +SG EA +A++L + TGR + + F +HG + Sbjct: 89 TQ---LARKIGELMPSIELVRMV---SSGTEATMSAIRLARGYTGRDKIVKFAGCYHGHS 142 Query: 156 QAVLSLTASKWVQQDGFFPTMPGVTHIPYPNPYRNTWGIDGYEEPDELTNRVL-----DF 210 ++L S + PT PGV P EL + L D Sbjct: 143 DSLLVKAGSGALTFG--VPTSPGV--------------------PKELAAQTLTLAYNDA 180 Query: 211 IEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGIG 270 E +I I EP+ G V P GF + L+ D++G +L DEV G Sbjct: 181 AEVKQVFDAVGGQIACIIVEPVAGNMNCVPPAPGFLETLRSVCDQHGSVLIFDEVMTGF- 239 Query: 271 RTGKFWAIEHFGVEPDLIQFGKAIGGGLPLAGVIHRADITFD----KPGRHATTFGGNPV 326 R A +G++PDL GK +GGG+P+ R DI P A T GNPV Sbjct: 240 RVALGGAQALYGIKPDLTTLGKIVGGGMPVGAFGGRRDIMEQIAPLGPVYQAGTLSGNPV 299 Query: 327 AIAAGIEVVEIVKE 340 A+AAG++ +E++ E Sbjct: 300 AMAAGLKTLELIGE 313 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 424 Length adjustment: 32 Effective length of query: 413 Effective length of database: 392 Effective search space: 161896 Effective search space used: 161896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory