Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_066920221.1 ACG33_RS08095 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_001579945.1:WP_066920221.1 Length = 319 Score = 363 bits (932), Expect = e-105 Identities = 175/307 (57%), Positives = 226/307 (73%), Gaps = 1/307 (0%) Query: 1 MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR 60 M + A +IW+NG++V WE A VHV++HALHYG++VFEG+RCY + +GPV+FR R+H +R Sbjct: 1 MPIQAAKHIWYNGKLVPWEKATVHVLAHALHYGSTVFEGVRCYATAQGPVIFRLRDHTRR 60 Query: 61 LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTS-AYIRPLIFVGDVGMGVNPPAGYSTD 119 L DSA+IYR + + DE+ AC+++I N L AY+RP F +GV P D Sbjct: 61 LFDSARIYRIDIPYTPDEINAACKEIIVVNGLDKGAYMRPFAFRSYGEIGVAPKTPPPID 120 Query: 120 VIIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHG 179 ++AAF WGAYLGA+ LE GID VSSW R A NTIP KA GNYLSS L+ EA+R G Sbjct: 121 TVVAAFEWGAYLGADGLENGIDVCVSSWQRLAANTIPALGKAAGNYLSSQLISMEAKRLG 180 Query: 180 YQEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVRE 239 + EGI L ++G +SEGAGENLF V+D V++TP ++ L GITRD +I LA+ G EVRE Sbjct: 181 FAEGIGLGIDGSVSEGAGENLFVVRDNVIYTPGLANAILQGITRDTVITLARIHGFEVRE 240 Query: 240 QVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETED 299 Q L RE LYLADE+F++G+AAEITPVRSVD I+VG G+ GPVT+ +Q AFFGLF G+TED Sbjct: 241 QALPREFLYLADEIFLTGSAAEITPVRSVDRIEVGSGKRGPVTEALQSAFFGLFDGKTED 300 Query: 300 KWGWLDQ 306 KWGWL++ Sbjct: 301 KWGWLER 307 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 319 Length adjustment: 27 Effective length of query: 282 Effective length of database: 292 Effective search space: 82344 Effective search space used: 82344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory