Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_068167016.1 HTA01S_RS02790 O-acetylhomoserine aminocarboxypropyltransferase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_001592305.1:WP_068167016.1 Length = 435 Score = 240 bits (613), Expect = 5e-68 Identities = 156/419 (37%), Positives = 224/419 (53%), Gaps = 46/419 (10%) Query: 19 TLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPG--------EHQGFEYSRTHNPTRFAYE 70 TLA+H G +PD +TGA PI+ T+++ S E G YSR NPT +E Sbjct: 11 TLALHAGATPD-ATGARAVPIHLTTSFVFESSDHAASLFNLERAGHVYSRISNPTNAVFE 69 Query: 71 RCVAALEGGTRAFAFASGMAATS-TVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGL 129 + +AALEGG A A ASG AA ++ L+ AGSH+VA LYGG+ L RR G+ Sbjct: 70 QRMAALEGGIGAIAVASGQAALHLSIATLMGAGSHIVASTALYGGSQNLLHYTLRRF-GI 128 Query: 130 DFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFA 189 + +FV D ++AA+R +T++ + ET NP L ++DI +A IA + + +VD+T Sbjct: 129 ETTFVKPGDIDGWRAAVRPNTRLFFGETVGNPGLDVLDIPTVAQIAHEAKVPLLVDSTLT 188 Query: 190 SPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDN---------AELAEQ------ 234 +P L +PL LGAD+V HSATK+L+GH ++GG+ V G + EL E Sbjct: 189 TPYLMKPLELGADIVYHSATKFLSGHGTVIGGVVVDGGSFDWEASGKFPELTEPYDGFHG 248 Query: 235 MAFLQNS----------------IGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQW 278 M F + S G P ++L L+G++TLPLRM H N + + Sbjct: 249 MTFSEESTVGAFLLRARREGLRDFGACLSPHSAWLILQGIETLPLRMERHMANTEKVVSF 308 Query: 279 LETHPAIEKVIYPGLASHPQHVLAKRQM----SGFGGIVSIVLKGGFDAAKRFCEKTELF 334 L +HP + +V +P L SHP H LA++ + G G + S ++G K F E +LF Sbjct: 309 LASHPLVGRVGHPLLESHPSHALAQKLLRHGAKGAGSVFSFDIQGSRAQGKAFIEALKLF 368 Query: 335 TLAESLGGVESLVNHPAVMTHASIPVARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393 + ++G SLV HPA TH + GI +RLS+G+ED DL DL+RAL Sbjct: 369 SHLANVGDCRSLVIHPASTTHFRMSDEALAGAGIGPGTIRLSIGLEDPDDLIDDLKRAL 427 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 435 Length adjustment: 31 Effective length of query: 366 Effective length of database: 404 Effective search space: 147864 Effective search space used: 147864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory