Align O-acetylhomoserine aminocarboxypropyltransferase (EC 2.5.1.49) (characterized)
to candidate WP_068171044.1 HTA01S_RS11305 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::P94890 (442 letters) >NCBI__GCF_001592305.1:WP_068171044.1 Length = 425 Score = 456 bits (1172), Expect = e-133 Identities = 236/433 (54%), Positives = 298/433 (68%), Gaps = 13/433 (3%) Query: 14 KPETIALHGGQEPDPTTTSRAVPLYQTTSYVFKDTDHAARLFGLQEFGNIYTRLMNPTTD 73 K ETIA+HGG PDPTT + AVP+YQT +Y F DT H A LF L+ GNIY+R+MNPT Sbjct: 2 KIETIAVHGGYTPDPTTKAVAVPIYQTVAYAFDDTQHGADLFDLKVAGNIYSRIMNPTNG 61 Query: 74 VLEKRVAALEGGVAALATASGQSAEMLALLNIVEAGQEIVASSSLYGGTYNLLHYTFPKL 133 VLE R+AALEGGV ALA ASG +A A+ I EAG IV++S+LYGGTYNL +TFP+ Sbjct: 62 VLEARLAALEGGVGALAMASGMAAITAAIQTIAEAGDNIVSASTLYGGTYNLFAHTFPQQ 121 Query: 134 GIKVHFVDQSDPENFRKASNDKTRAFYAETLGNPKLDTLDIAAVSKVAKEVGVPLVIDNT 193 GI V F D DP F ++KT+A Y E++GNP + DI A++ VA GVPL++DNT Sbjct: 122 GITVRFADPRDPAAFAALIDEKTKAIYCESIGNPLGNVTDIGALAAVAHAAGVPLIVDNT 181 Query: 194 MPSPYLVNPLKHGADIVVHSLTKFLGGHGTSIGGIIIDGGSFNWGNGK--FKNFTEPDPS 251 + SPYL P +HGADIVVHSLTK+LGGHGTSIGG I+D G+F W K FK EPD S Sbjct: 182 VTSPYLCRPFEHGADIVVHSLTKYLGGHGTSIGGAIVDSGTFPWAQHKARFKRLNEPDVS 241 Query: 252 YHGLKFWEVFGKFEPFGGVNIAFILKARVQGLRDLGPAISPFNAWQILQGVETLPLRMER 311 YHG+ + E G A+I +ARV LR++G A+SP NA+QILQG+ETL LRM+R Sbjct: 242 YHGVVYTEALGA--------AAYIGRARVVPLRNMGAALSPMNAFQILQGIETLALRMDR 293 Query: 312 HSGNALKVAEFLQKHPKIEWVNYPGLSTDKNYATAKKYHERGLFGAIVGFEIKG--GVEK 369 NA+KVA LQ HPK+ WVNY GL K++A ++Y G I+ F +K + Sbjct: 294 ICENAVKVATHLQNHPKVAWVNYAGLPDHKDHALVQQY-MGGRASGIISFGLKSSDAIAA 352 Query: 370 AKKFIDGLELFSLLANIGDAKSLAIHPASTTHQQLTGPEQISAGVTPGFVRLSVGLENID 429 +F D L+LF+ L NIGDAKSLA HPA+TTH+QL E AGV+P VRLS+G+E+ID Sbjct: 353 GTRFQDALQLFTRLVNIGDAKSLACHPATTTHRQLNPDEMKKAGVSPDMVRLSIGIEHID 412 Query: 430 DILVDLEEALKNI 442 D++ DLE+AL + Sbjct: 413 DLMADLEQALSKV 425 Lambda K H 0.317 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 425 Length adjustment: 32 Effective length of query: 410 Effective length of database: 393 Effective search space: 161130 Effective search space used: 161130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory