Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate WP_066553020.1 A4249_RS12380 molybdopterin-synthase adenylyltransferase MoeB
Query= SwissProt::P9WMN7 (392 letters) >NCBI__GCF_001636925.1:WP_066553020.1 Length = 244 Score = 216 bits (551), Expect = 4e-61 Identities = 113/246 (45%), Positives = 155/246 (63%), Gaps = 8/246 (3%) Query: 16 SREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFD 75 S +EV RY+RHL++ ++G GQ+ LK ARVL++GAGG+G+P LYLAAAGVG +G++D D Sbjct: 4 SEDEVERYARHLVLSEVGGPGQQALKRARVLIVGAGGVGSPAALYLAAAGVGALGLIDDD 63 Query: 76 VVDESNLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDL 135 VV SNLQRQ+ A VGRSK ++A + +V +NP + + R+ NA + +D+ Sbjct: 64 VVGLSNLQRQIAFSTAQVGRSKVEAAAERLVGLNPHVAIETFAERITAENAAARIEAFDI 123 Query: 136 ILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPP 195 +LDGTD+F TR VN A V AGKP V G++ R+ GQ VF Y+ L PE P Sbjct: 124 VLDGTDDFQTRLWVNAACVAAGKPLVSGALGRWNGQVGVFSGQP------CYQCLVPEIP 177 Query: 196 PPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYRTITIR 255 P +CA GV+G + + S+ E +KLITG GE L GRL++YD L S RT+ + Sbjct: 178 PD--AETCARVGVVGALTGVIGSMAALEVVKLITGAGEALTGRLMLYDGLAGSARTVRVA 235 Query: 256 KDPSTP 261 DP P Sbjct: 236 ADPECP 241 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 244 Length adjustment: 27 Effective length of query: 365 Effective length of database: 217 Effective search space: 79205 Effective search space used: 79205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory