GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Nocardioides dokdonensis FR1436

Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_068112647.1 I601_RS17670 aconitate hydratase

Query= BRENDA::Q9ZW84
         (256 letters)



>NCBI__GCF_001653335.1:WP_068112647.1
          Length = 936

 Score = 43.9 bits (102), Expect = 1e-08
 Identities = 40/118 (33%), Positives = 56/118 (47%), Gaps = 6/118 (5%)

Query: 139 IIIGGENFGCGSSREHAPVCLGAAGAKAIVAESYARIFFRNSVATGEVFPLESEVRVCEE 198
           +++ G+ +G GSSR+ A       G KA++AESY RI   N +  G V PL+       E
Sbjct: 811 VVLAGKEYGSGSSRDWAAKGTALLGVKAVIAESYERIHRSNLIGMG-VLPLQYPEGESAE 869

Query: 199 CKTGDTVTIELSDSGGL-LTNHTTGKNYKLKSIG---DAGPVIDAGGIFAYARMMGMI 252
              G T     S SG   L + TT +  K+ + G   DA   ID  G   Y R  G++
Sbjct: 870 -SLGLTGEETFSVSGVTELNDGTTPRTVKVTADGVEFDAVVRIDTPGEANYYRNGGIM 926


Lambda     K      H
   0.316    0.131    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 479
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 256
Length of database: 936
Length adjustment: 34
Effective length of query: 222
Effective length of database: 902
Effective search space:   200244
Effective search space used:   200244
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory