Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_068112647.1 I601_RS17670 aconitate hydratase
Query= BRENDA::Q9ZW84 (256 letters) >NCBI__GCF_001653335.1:WP_068112647.1 Length = 936 Score = 43.9 bits (102), Expect = 1e-08 Identities = 40/118 (33%), Positives = 56/118 (47%), Gaps = 6/118 (5%) Query: 139 IIIGGENFGCGSSREHAPVCLGAAGAKAIVAESYARIFFRNSVATGEVFPLESEVRVCEE 198 +++ G+ +G GSSR+ A G KA++AESY RI N + G V PL+ E Sbjct: 811 VVLAGKEYGSGSSRDWAAKGTALLGVKAVIAESYERIHRSNLIGMG-VLPLQYPEGESAE 869 Query: 199 CKTGDTVTIELSDSGGL-LTNHTTGKNYKLKSIG---DAGPVIDAGGIFAYARMMGMI 252 G T S SG L + TT + K+ + G DA ID G Y R G++ Sbjct: 870 -SLGLTGEETFSVSGVTELNDGTTPRTVKVTADGVEFDAVVRIDTPGEANYYRNGGIM 926 Lambda K H 0.316 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 936 Length adjustment: 34 Effective length of query: 222 Effective length of database: 902 Effective search space: 200244 Effective search space used: 200244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory