Align L-2-aminoadipate aminotransferase monomer (EC 2.6.1.39) (characterized)
to candidate WP_068107481.1 I601_RS06255 PLP-dependent aminotransferase family protein
Query= metacyc::MONOMER-6727 (397 letters) >NCBI__GCF_001653335.1:WP_068107481.1 Length = 437 Score = 237 bits (605), Expect = 4e-67 Identities = 143/403 (35%), Positives = 216/403 (53%), Gaps = 15/403 (3%) Query: 5 SWSEAFGKSAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKG 64 S+ + + + AS IR L + RP ++S AGG+P P + A + ++ +G Sbjct: 14 SFVDLYAARTAGMTASEIRALFAVASRPEVVSLAGGMPNISGLPLDVVGSAISDLVEHQG 73 Query: 65 EVALQYSPTEGYAPLRAFVA-----EWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVL 119 VA+QY +G LR + E I P++V++T GSQQA+DLV +VF D G V+ Sbjct: 74 TVAMQYGSGQGLPELREQITDVMRLEGIEAHPDDVVVTVGSQQAVDLVTRVFCDPGDVVI 133 Query: 120 LEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKR-----ERPRFLYLIPSFQN 174 EAPSY+GA+ FR + G +AL + ++ +FLY IP+F N Sbjct: 134 CEAPSYVGALGVFRAYQAEVVHAEMDAHGLVPEALRHAIATVKAAGKKIKFLYTIPNFHN 193 Query: 175 PTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLG 234 P G R +L++ + G++++ED+ Y L F L +L R GVIYLG Sbjct: 194 PAGVTMSAQRRTEVLEICRDEGVLILEDNPYGLLGFEREPLRAL----RADEADGVIYLG 249 Query: 235 SFSKVLSPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELL-KEGFSERLERV 293 SFSK +PG RV +A+A +KLV A++ A L P +QM V L K + ++++ Sbjct: 250 SFSKTFAPGFRVGWALAPHPVREKLVLAQESATLCPPQFSQMAVSAYLAKHDWVGQIKQF 309 Query: 294 RRVYREKAQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAFVP 353 R +YRE+ AM+ AL +P + P+GG +VW+ LP G+ A+ + RA+ VA+VP Sbjct: 310 REMYRERRDAMISALGDMMPAGCSWNVPEGGFYVWLSLPPGIDAKAMLPRAVTSRVAYVP 369 Query: 354 GGPFFANGGGENTLRLSYATLDREGIAEGVRRLGRALKGLLAL 396 G F+A+G G +RLS+ E I EGVRRL L+ + L Sbjct: 370 GTAFYADGFGSGAMRLSFCYPTPERIREGVRRLAGVLEAEIEL 412 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 437 Length adjustment: 31 Effective length of query: 366 Effective length of database: 406 Effective search space: 148596 Effective search space used: 148596 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory