Align Ornithine aminotransferase; OAT; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase (uncharacterized)
to candidate WP_068111454.1 I601_RS15155 acetylornithine transaminase
Query= curated2:Q89RB7 (404 letters) >NCBI__GCF_001653335.1:WP_068111454.1 Length = 396 Score = 258 bits (658), Expect = 3e-73 Identities = 153/388 (39%), Positives = 212/388 (54%), Gaps = 21/388 (5%) Query: 18 HNYEPIGVVLSRGEGVWVWDTDGNRYLDCLSAYSAVSQGHCHPKILAAMVEQAHRLTLTS 77 + + P + L RGEG VWD DG Y+D L + + GH HP ++AA+ +Q L S Sbjct: 23 NTFGPPKLTLVRGEGAHVWDADGKEYVDLLGGIAVNALGHAHPALVAAVTDQLSTLGHIS 82 Query: 78 RAFHNDQLAPFYEEIAALTGSH--KVLPMNSGAEAVESAIKSVRKWGYEVKGVPDDQAEI 135 F + E++ AL G+ KV NSGAEA E+A K R+ G + + Sbjct: 83 NFFTSVPQVELAEKLVALVGAGPGKVFLANSGAEANEAAFKMTRRTG---------RTHV 133 Query: 136 IVCADNFHGRTLGIVGFSTDPETRGHFGPFAPGFRIIPFGDAAALEQAITPNTVAFLVEP 195 +V FHGRT+G + ++ R F P +P+GD AL +A+T T A L+EP Sbjct: 134 VVAEGGFHGRTMGALALTSKAAYREPFEPLPGDVTFVPYGDVDALREAVTETTAAILLEP 193 Query: 196 IQGEAGVIIPPAGYFTKVRELCTANNVMLVLDEIQTGLGRTGKLLAEQHEG-IEADVTLL 254 IQGEAGV++ PAGY R L + +L LDE+QTG+GRTG A H G + D+ L Sbjct: 194 IQGEAGVVMAPAGYLRAARALADESGALLWLDEVQTGMGRTGDWFA--HAGHVVPDILTL 251 Query: 255 GKALAGGFYPVSAVLSNNEVLGTLRPGQHGSTFGGNPLACAVARAAMRVLVEEGMIENAA 314 K L GG YP+ AV+ L PG HG+TFGG+P+ACA A A +R + E+G++E+ Sbjct: 252 AKGLGGG-YPIGAVVGLGRAADLLEPGNHGTTFGGSPVACAAALAVIRTIEEDGLLEHVR 310 Query: 315 RQGARLLEGL-KDIRANTVREVRGRGLMLAVELHPEAGRARRYCEALQGKGILAKDTHGH 373 R G RL EGL D R V EVRG GL++ ++L E A EA Q G + Sbjct: 311 RAGERLREGLAADAR---VTEVRGEGLLIGLDLVSETAAA--VVEAAQRAGFIVNMPTPS 365 Query: 374 TIRIAPPLVITSDEVDWALEQFATTLTQ 401 IR+APPLV+T +++ L + T L + Sbjct: 366 RIRLAPPLVLTDADIESFLTAWPTILDE 393 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 26 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 396 Length adjustment: 31 Effective length of query: 373 Effective length of database: 365 Effective search space: 136145 Effective search space used: 136145 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory