Align L-serine ammonia-lyase (EC 4.3.1.17) (characterized)
to candidate WP_075859204.1 cpu_RS06395 cysteine synthase A
Query= BRENDA::B1N2N4 (423 letters) >NCBI__GCF_001950255.1:WP_075859204.1 Length = 306 Score = 95.1 bits (235), Expect = 3e-24 Identities = 86/267 (32%), Positives = 129/267 (48%), Gaps = 23/267 (8%) Query: 52 ISKKVGCKTYLKLENLQKTGSFKVRGAVNKIATLTEE---EKKRGVVAASAGNHAQGVAF 108 +SK KLE GS K R A N I E+ +K ++ ++GN G+A Sbjct: 22 VSKDAKATVVAKLEYFNPGGSVKDRIAYNMIKAAEEKGLLDKDTVIIEPTSGNTGIGLAM 81 Query: 109 ASTSAGCKATIVMPEFASTAKVTATRGYGAEVVLH-GKV-FDESLAYAMQLCKEEGKTFV 166 + + G + I MPE S + + YGAE+VL G++ ++ A++L KE K+F+ Sbjct: 82 VAAARGYRLIITMPETMSVERRMLLKAYGAEIVLTPGELGMTGAVNKALELAKEYPKSFI 141 Query: 167 -HPFNDPW-VMAGQGTIALEILEQLE-KCDVIIGAIGGGGLMSGVAFAAKQIKPEIRIIG 223 F +P + T ALEI E + K D+++G +G GG ++GV K KPE++II Sbjct: 142 PQQFENPANPEIHRQTTALEIWEDTDGKVDIVVGGVGTGGTITGVGEVLKAKKPEVKIIA 201 Query: 224 VQAAECPSMAVSK-AEHKICCVKTAKTMADGIAVKAPGDKTAPVLLKYVDEIVTVD-EES 281 V+ A P ++ K HKI GI G + L +DEI+ V+ E++ Sbjct: 202 VEPAASPVLSGGKPGPHKI----------QGIGA---GFIPKVLNLDVIDEIIRVENEDA 248 Query: 282 IAQAMLLMLERCKIVSEGSGATPVAAL 308 A A L E +V SGA AAL Sbjct: 249 FATAKELAREEGVLVGISSGAALWAAL 275 Lambda K H 0.317 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 423 Length of database: 306 Length adjustment: 29 Effective length of query: 394 Effective length of database: 277 Effective search space: 109138 Effective search space used: 109138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory