GapMind for Amino acid biosynthesis

 

Alignments for a candidate for cmutase in Carboxydothermus pertinax Ug1

Align Chorismate mutase AroH; EC 5.4.99.5 (characterized)
to candidate WP_075859776.1 cpu_RS09535 chorismate mutase

Query= SwissProt::Q84FH6
         (122 letters)



>NCBI__GCF_001950255.1:WP_075859776.1
          Length = 118

 Score =  103 bits (256), Expect = 1e-27
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 4/118 (3%)

Query: 1   MVRGIRGAITVEEDTPEAIHQATRELLLKMLEANGIQSYEELAAVIFTVTEDLTSAFPAE 60
           +V+GIRGAITV E++ EAI + T++LL ++   N ++  E++ ++ FT+T DL + FPA 
Sbjct: 3   VVKGIRGAITVTENSAEAIEEQTKKLLTEIFLQNNLKK-EKIISIFFTLTPDLNAQFPAT 61

Query: 61  AARQIGMHRVPLLSAREVPVPGSLPRVIRVLALWNTDTPQD-RVRHVYLREAVRLRPD 117
           AAR+ G+  VPLL A+E+ VPGSL +VIR+L L  T  P++ +V H+YL  A  LRPD
Sbjct: 62  AARKAGLTEVPLLCAQEIAVPGSLKKVIRILIL--TYLPENQKVHHLYLEGAKVLRPD 117


Lambda     K      H
   0.320    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 55
Number of extensions: 3
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 122
Length of database: 118
Length adjustment: 13
Effective length of query: 109
Effective length of database: 105
Effective search space:    11445
Effective search space used:    11445
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 41 (20.4 bits)

Align candidate WP_075859776.1 cpu_RS09535 (chorismate mutase)
to HMM TIGR01796 (aroH: chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01796.hmm
# target sequence database:        /tmp/gapView.3607198.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01796  [M=117]
Accession:   TIGR01796
Description: CM_mono_aroH: chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                             Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                             -----------
    3.9e-45  139.3   0.0    4.3e-45  139.1   0.0    1.0  1  NCBI__GCF_001950255.1:WP_075859776.1  


Domain annotation for each sequence (and alignments):
>> NCBI__GCF_001950255.1:WP_075859776.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  139.1   0.0   4.3e-45   4.3e-45       1     117 []       4     118 .]       4     118 .] 0.96

  Alignments for each domain:
  == domain 1  score: 139.1 bits;  conditional E-value: 4.3e-45
                             TIGR01796   1 lravrGattveaneaeeileaveeLleellerneltaedlisviltvteDlsaafPakavrelaGiedvpvlc 73 
                                           ++++rGa+tv +n+ae+i e++++Ll+e+  +n+l+ e++is+++t t+Dl+a+fPa a+r+  G+++vp+lc
  NCBI__GCF_001950255.1:WP_075859776.1   4 VKGIRGAITVTENSAEAIEEQTKKLLTEIFLQNNLKKEKIISIFFTLTPDLNAQFPATAARKA-GLTEVPLLC 75 
                                           789*********************************************************986.6******** PP

                             TIGR01796  74 aqeldvegslercirvlihiesekarseiahvyLreakkLrpDl 117
                                           aqe+ v+gsl+++ir+li ++  + + +++h+yL++ak+LrpD+
  NCBI__GCF_001950255.1:WP_075859776.1  76 AQEIAVPGSLKKVIRILILTY-LPENQKVHHLYLEGAKVLRPDF 118
                                           *********************.677889**************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (117 nodes)
Target sequences:                          1  (118 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 2.19
//
[ok]

This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory