Align Chorismate mutase AroH; EC 5.4.99.5 (characterized)
to candidate WP_075859776.1 cpu_RS09535 chorismate mutase
Query= SwissProt::Q84FH6 (122 letters) >NCBI__GCF_001950255.1:WP_075859776.1 Length = 118 Score = 103 bits (256), Expect = 1e-27 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 4/118 (3%) Query: 1 MVRGIRGAITVEEDTPEAIHQATRELLLKMLEANGIQSYEELAAVIFTVTEDLTSAFPAE 60 +V+GIRGAITV E++ EAI + T++LL ++ N ++ E++ ++ FT+T DL + FPA Sbjct: 3 VVKGIRGAITVTENSAEAIEEQTKKLLTEIFLQNNLKK-EKIISIFFTLTPDLNAQFPAT 61 Query: 61 AARQIGMHRVPLLSAREVPVPGSLPRVIRVLALWNTDTPQD-RVRHVYLREAVRLRPD 117 AAR+ G+ VPLL A+E+ VPGSL +VIR+L L T P++ +V H+YL A LRPD Sbjct: 62 AARKAGLTEVPLLCAQEIAVPGSLKKVIRILIL--TYLPENQKVHHLYLEGAKVLRPD 117 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 55 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 122 Length of database: 118 Length adjustment: 13 Effective length of query: 109 Effective length of database: 105 Effective search space: 11445 Effective search space used: 11445 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 41 (20.4 bits)
Align candidate WP_075859776.1 cpu_RS09535 (chorismate mutase)
to HMM TIGR01796 (aroH: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01796.hmm # target sequence database: /tmp/gapView.3607198.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01796 [M=117] Accession: TIGR01796 Description: CM_mono_aroH: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-45 139.3 0.0 4.3e-45 139.1 0.0 1.0 1 NCBI__GCF_001950255.1:WP_075859776.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001950255.1:WP_075859776.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 139.1 0.0 4.3e-45 4.3e-45 1 117 [] 4 118 .] 4 118 .] 0.96 Alignments for each domain: == domain 1 score: 139.1 bits; conditional E-value: 4.3e-45 TIGR01796 1 lravrGattveaneaeeileaveeLleellerneltaedlisviltvteDlsaafPakavrelaGiedvpvlc 73 ++++rGa+tv +n+ae+i e++++Ll+e+ +n+l+ e++is+++t t+Dl+a+fPa a+r+ G+++vp+lc NCBI__GCF_001950255.1:WP_075859776.1 4 VKGIRGAITVTENSAEAIEEQTKKLLTEIFLQNNLKKEKIISIFFTLTPDLNAQFPATAARKA-GLTEVPLLC 75 789*********************************************************986.6******** PP TIGR01796 74 aqeldvegslercirvlihiesekarseiahvyLreakkLrpDl 117 aqe+ v+gsl+++ir+li ++ + + +++h+yL++ak+LrpD+ NCBI__GCF_001950255.1:WP_075859776.1 76 AQEIAVPGSLKKVIRILILTY-LPENQKVHHLYLEGAKVLRPDF 118 *********************.677889**************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (117 nodes) Target sequences: 1 (118 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 2.19 // [ok]
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory