Align aspartate-prephenate aminotransferase (EC 2.6.1.78) (characterized)
to candidate WP_077279793.1 B1C78_RS13840 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= BRENDA::Q56232 (385 letters) >NCBI__GCF_002000365.1:WP_077279793.1 Length = 431 Score = 175 bits (443), Expect = 2e-48 Identities = 121/389 (31%), Positives = 188/389 (48%), Gaps = 21/389 (5%) Query: 4 LSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTK 63 L+ + + SAT+A+N + +RR+G + + G+ F PE V EA R Q Sbjct: 13 LNLNARGLPQSATLAINERCAAMRREGRSVFRMGLGQSPFPVPEPVVEALRANSHQ--KD 70 Query: 64 YAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSP 123 Y P G+PELR+A+ + R GLS + + +V G K+ +F + ++ GD +++ +P Sbjct: 71 YLPVKGLPELRQAIVDYLHRHEGLSFSADHVLVGPGTKELMFIV--QLVYYGD-LVIPTP 127 Query: 124 YWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVR---RAITPRTKALVVNSPNNPTGAV 180 WVSY G + + T PE G PE + R R + L++NSP NPTG+ Sbjct: 128 SWVSYAPQAHIIGRHLRWLPTHPETGLGVTPEALDALCRVDPDRPRLLILNSPGNPTGSA 187 Query: 181 YPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTG 240 Y E L+A+A +A + ++SDEIY L +EG+H S R PE T+ NG +K G Sbjct: 188 YAVEQLQAIAEVARRYRVLVLSDEIYSGLHFEGKHVSIARFYPEGTIISNGLSKWCGAGG 247 Query: 241 WRIGYACGPKE---VIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYR 297 WR+G P+ +++ MASV+S++ TS Q+A + A ++ R R Sbjct: 248 WRLGALAFPRSLTWLLEPMASVASETFTSTSAPIQYAAVRAFEGGPEIEHYLTQCRRILR 307 Query: 298 RRRDLLLEGLTALGLKAVRPSGAFYVLMDTSP---------IAPDEVRAAERLLEAGVAV 348 E + A+G A P G FY+ + P I E L + GVA Sbjct: 308 AIAHYTWESVRAVGAVATEPKGGFYLFPNFDPLRERLASRGITTSEQLCLHLLEDTGVAC 367 Query: 349 VPGTDFA-AFGHVRLSYATSEENLRKALE 376 +PG F + + A + + +KALE Sbjct: 368 LPGEAFGRPLDELSVRLALVDFDGQKALE 396 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 467 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 431 Length adjustment: 31 Effective length of query: 354 Effective length of database: 400 Effective search space: 141600 Effective search space used: 141600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory