Align Aminodeoxychorismate/anthranilate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85; EC 4.1.3.27 (characterized)
to candidate WP_075385892.1 BK574_RS23580 carbamoyl phosphate synthase small subunit
Query= SwissProt::P28819 (194 letters) >NCBI__GCF_002019605.1:WP_075385892.1 Length = 359 Score = 74.7 bits (182), Expect = 2e-18 Identities = 45/137 (32%), Positives = 65/137 (47%), Gaps = 8/137 (5%) Query: 37 DEIEELSPDFLMISPGPCSPDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRA 96 + I L PD +++S GP +P + L IK A P FG+CLGHQ +A FG D + Sbjct: 201 ETIVTLKPDGILLSNGPGNPKQMAAQLNDIKKLAATYPTFGICLGHQLLALAFGADTEKL 260 Query: 97 ERLMHGKTSDIEHDGKTIFEGLKNPLVATRYHSLIVKPETLPSCFTVT--AQTKEGEIMA 154 R H + D T K + ++ HS +VK +L V +G + Sbjct: 261 -RFGHRGANQPVQDLLT-----KRVYMTSQNHSYVVKENSLQDTGLVARYKNINDGSVEG 314 Query: 155 IRHNDLPIEGVQFHPES 171 + H LP+ VQFHPE+ Sbjct: 315 LIHTQLPVASVQFHPEA 331 Lambda K H 0.320 0.139 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 194 Length of database: 359 Length adjustment: 25 Effective length of query: 169 Effective length of database: 334 Effective search space: 56446 Effective search space used: 56446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory