Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_085773239.1 B1812_RS20525 LL-diaminopimelate aminotransferase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_002117405.1:WP_085773239.1 Length = 408 Score = 405 bits (1040), Expect = e-117 Identities = 200/390 (51%), Positives = 266/390 (68%), Gaps = 5/390 (1%) Query: 7 FPKVKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHG 66 F ++++LP YVF VN LK + R G DIVDLGMGNPD+P +H+++KL E A +P Sbjct: 4 FYRIQRLPPYVFEQVNRLKAKARAGGADIVDLGMGNPDLPAPRHVVEKLVETAGKPRTDR 63 Query: 67 YSASKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGDTVIVPN 126 YSASKGIP LR+A +Y+RR+GV LDPE + T+G+KEG++++ A+ PGD V+ PN Sbjct: 64 YSASKGIPGLRRAQASYYRRRFGVALDPETQIVATLGSKEGFANMAQAITAPGDVVLTPN 123 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTT 186 P+YPIH + ++ GG SVP P P+ F L +K S KP AVV+ +P NPT Sbjct: 124 PSYPIHAFGFLMAGGVVRSVPAEPT---PQYFAA-LERAVKHSIPKPIAVVVCYPANPTA 179 Query: 187 LCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKG 246 L+F++++V AK+ I+I+ D AYA++ FD PPS+LQ GA+DV VE SMSK Sbjct: 180 ALASLDFYKDLVAFAKKHEIFILSDVAYAEVYFDDEPPPSVLQAPGAIDVTVEFTSMSKT 239 Query: 247 FSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTPIQVASIIALESPYEVVEKNREIYRR 306 FSMAGWR+ F GNE L LA +KSYLDYG FTPIQVA+ AL P + + + R IYRR Sbjct: 240 FSMAGWRIGFAAGNERLCAALARVKSYLDYGAFTPIQVAAAAALNGPEDCIAEMRAIYRR 299 Query: 307 RRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVG-MNSLDFSLFLLREAKVAVSPGIGFG 365 RRDVLVE + GW + P+ SMF WA +PE + SL+FS L+ +A +AV+PG+GFG Sbjct: 300 RRDVLVESFAQAGWTIPSPRASMFAWAPIPERFAELTSLEFSSLLIEKADLAVAPGVGFG 359 Query: 366 EYGEGYVRFALVENEHRIRQAVRGIKKALD 395 E+GEG++R ALVENE RIRQA R ++K D Sbjct: 360 EHGEGFLRLALVENEQRIRQAARNLRKFFD 389 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 408 Length adjustment: 31 Effective length of query: 371 Effective length of database: 377 Effective search space: 139867 Effective search space used: 139867 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory