Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (uncharacterized)
to candidate WP_085772938.1 B1812_RS18690 pyridoxal phosphate-dependent aminotransferase
Query= curated2:B1I544 (392 letters) >NCBI__GCF_002117405.1:WP_085772938.1 Length = 400 Score = 177 bits (450), Expect = 4e-49 Identities = 130/398 (32%), Positives = 192/398 (48%), Gaps = 19/398 (4%) Query: 1 MSFVEAKRIRNLPPYLFARIEQLIADKKAQGVDVISLGIGDPDVPTPDHIIEAAEKELKI 60 MSF+ A R P A ++ D KAQG +VISL +G+PD TP HI +AA+ + Sbjct: 1 MSFLAAALSRVKPSATIAATQKA-RDLKAQGREVISLSVGEPDFDTPRHICDAAKAAID- 58 Query: 61 PANHQYPSSAGMPAYRRAVADWYARRFGVELDPQREVVSLIGSKEGIAHLPWCFVDPGDV 120 +Y G+P R AVA + R G++ +V+ G K + + ++PGD Sbjct: 59 RGETRYTPVLGIPELRAAVAKKFKRENGLDYRASDTIVAT-GGKHILFNAFLATLNPGDE 117 Query: 121 VLVPDPGYPVYAGGTILAGGIPHPVPLTAGNGFLPDLAAIPAETARRAKVMFINYPNNPT 180 V+VP P + Y + GG PV GF A+ + K + +N P+NP+ Sbjct: 118 VIVPAPYWVSYPEMVAICGGTAVPVETQMEQGFKLQPEALERAITPKTKWLVLNSPSNPS 177 Query: 181 GAVASKEFFARVVD-FAREYGILVCHDAAYSEIAFDGYRPPSFLEVA-GAREVGIEFHSV 238 GA S++ +V D R + V D Y + + G++ + EV G E + + V Sbjct: 178 GAAYSRDEMKKVTDVLMRHPQVHVLTDDIYEHLVYGGFKFVTPAEVEPGLFERTLTMNGV 237 Query: 239 SKTYNMTGWRAGWAAGNAGAVEALGRLKSNLDSGVFQVVQYAAIAALNGPQDGVQSLCEM 298 SK Y MTGWR G+AAG A ++A+ L+ SG + Q+AA+AAL GPQD + S + Sbjct: 238 SKAYAMTGWRIGYAAGPAPLIKAMDLLQGQQTSGACSIAQWAAVAALEGPQDHLASFRKA 297 Query: 299 YRERRDLVVDTLNDLG-WRLTRPRATFYIW--------APVPAGHDASSFAEMV---LEK 346 + ERRDLVV LN P FY++ AG +S A+ V LE Sbjct: 298 FEERRDLVVSMLNQAAHLNCPTPEGAFYVFPSCAAAIGKTTAAGKQIASDADFVAELLEA 357 Query: 347 AGVVITPGTGYGTYGEGYFRISLTLPTPRLVEAMERLR 384 GV + G+ +GT FR+S T L A +++ Sbjct: 358 EGVAVVQGSAFGTGPN--FRVSYAASTELLERACAKIQ 393 Lambda K H 0.321 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 400 Length adjustment: 31 Effective length of query: 361 Effective length of database: 369 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory