Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate WP_085773239.1 B1812_RS20525 LL-diaminopimelate aminotransferase
Query= SwissProt::Q2RK33 (390 letters) >NCBI__GCF_002117405.1:WP_085773239.1 Length = 408 Score = 337 bits (865), Expect = 3e-97 Identities = 157/386 (40%), Positives = 247/386 (63%), Gaps = 3/386 (0%) Query: 1 MQEARRIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPE 60 M + RI+ LPPY+F ++ + A+AR G DI+ LG+G+PD+P P HV++KLV A P Sbjct: 1 MPDFYRIQRLPPYVFEQVNRLKAKARAGGADIVDLGMGNPDLPAPRHVVEKLVETAGKPR 60 Query: 61 NHRYPTSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINL 120 RY S+G+ R+A A +Y+R +GV LDP ++V +GSKEG A+++ PGD+ L Sbjct: 61 TDRYSASKGIPGLRRAQASYYRRRFGVALDPETQIVATLGSKEGFANMAQAITAPGDVVL 120 Query: 121 VPDPGYPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGA 180 P+P YP++ G L+AGG +P + L + + + YP NPT A Sbjct: 121 TPNPSYPIHAFGFLMAGGVVRSVPAEPTPQYFAALERAVKHSIPKPIAVVVCYPANPTAA 180 Query: 181 VADLKFFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPY 240 +A L F++++V FA+ +++ + D AY+E+ +D PS LQAPGA +V +EF S+SK + Sbjct: 181 LASLDFYKDLVAFAKKHEIFILSDVAYAEVYFDDEPPPSVLQAPGAIDVTVEFTSMSKTF 240 Query: 241 NMTGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQER 300 +M GWR+G+A G + ALAR+KS +D GAF +Q A AAL GP++ +AE+R +Y+ R Sbjct: 241 SMAGWRIGFAAGNERLCAALARVKSYLDYGAFTPIQVAAAAALNGPEDCIAEMRAIYRRR 300 Query: 301 RDIIVEGFNSLGWHLEKPKATFYVWAPVPRGY---TSASFAEMVLEKAGVIITPGNGYGN 357 RD++VE F GW + P+A+ + WAP+P + TS F+ +++EKA + + PG G+G Sbjct: 301 RDVLVESFAQAGWTIPSPRASMFAWAPIPERFAELTSLEFSSLLIEKADLAVAPGVGFGE 360 Query: 358 YGEGYFRIALTISKERMQEAIERLRR 383 +GEG+ R+AL +++R+++A LR+ Sbjct: 361 HGEGFLRLALVENEQRIRQAARNLRK 386 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 408 Length adjustment: 31 Effective length of query: 359 Effective length of database: 377 Effective search space: 135343 Effective search space used: 135343 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory