Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_085772938.1 B1812_RS18690 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_002117405.1:WP_085772938.1 Length = 400 Score = 161 bits (408), Expect = 3e-44 Identities = 115/363 (31%), Positives = 181/363 (49%), Gaps = 16/363 (4%) Query: 3 VSRLRPYATTVFAEMSALATRIG--AVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPG 60 +SR++P AT + + G ++L G PD D P + AA+ AI G +Y P Sbjct: 8 LSRVKPSATIAATQKARDLKAQGREVISLSVGEPDFDTPRHICDAAKAAIDRGETRYTPV 67 Query: 61 PGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYD 120 G LR A+A + +R G+DY ++ +V G + A L + PG EV++ P++ Sbjct: 68 LGIPELRAAVAKKFKRENGLDYRA-SDTIVATGGKHILFNAFLATLNPGDEVIVPAPYWV 126 Query: 121 SYSPVVAMAGAHRVTVPLVPDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATE 180 SY +VA+ G V V + +GF L +AL RA+TP+T+ L++NSP NP+GA S E Sbjct: 127 SYPEMVAICGGTAVPVETQME-QGFKLQPEALERAITPKTKWLVLNSPSNPSGAAYSRDE 185 Query: 181 LAAIAEIAVAANLV-VITDEVYEHLVFDHARHLPLAGFD-GMAERTITISSAAKMFNCTG 238 + + ++ + V V+TD++YEHLV+ + + A + G+ ERT+T++ +K + TG Sbjct: 186 MKKVTDVLMRHPQVHVLTDDIYEHLVYGGFKFVTPAEVEPGLFERTLTMNGVSKAYAMTG 245 Query: 239 WKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRL 298 W+IG+A GPA LI + + + + Q A AL+ +A+ R + RRD + Sbjct: 246 WRIGYAAGPAPLIKAMDLLQGQQTSGACSIAQWAAVAALEGPQDHLASFRKAFEERRDLV 305 Query: 299 AAGLT----------EIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPM 348 + L E F V S +F A L E GVA + Sbjct: 306 VSMLNQAAHLNCPTPEGAFYVFPSCAAAIGKTTAAGKQIASDADFVAELLEAEGVAVVQG 365 Query: 349 SAF 351 SAF Sbjct: 366 SAF 368 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 400 Length adjustment: 31 Effective length of query: 366 Effective length of database: 369 Effective search space: 135054 Effective search space used: 135054 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory