Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_085772938.1 B1812_RS18690 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_002117405.1:WP_085772938.1 Length = 400 Score = 226 bits (575), Expect = 1e-63 Identities = 146/387 (37%), Positives = 213/387 (55%), Gaps = 20/387 (5%) Query: 14 ISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQA 73 I+ +K +L AQ +VISL++G+PDF TP H+ AAK AID T YTP G ELR A Sbjct: 17 IAATQKARDLKAQGREVISLSVGEPDFDTPRHICDAAKAAIDRGETRYTPVLGIPELRAA 76 Query: 74 VQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLC 133 V K++ +Y A S+ I+ TG + AF L+PGDEVI+P P + Y ++ +C Sbjct: 77 VAKKFKRENGLDYRA-SDTIVATGGKHILFNAFLATLNPGDEVIVPAPYWVSYPEMVAIC 135 Query: 134 GAKPVIVDT-TSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIA-ALLK 191 G V V+T GFKL +E A+TP TK +VL PSNP+G S +E+K + L++ Sbjct: 136 GGTAVPVETQMEQGFKLQPEALERAITPKTKWLVLNSPSNPSGAAYSRDEMKKVTDVLMR 195 Query: 192 GRNVFVLSDEIYSELTYDRPHY----SIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPK 247 V VL+D+IY L Y + + L ++T+ +NG+SK+++MTGWRIG+ P Sbjct: 196 HPQVHVLTDDIYEHLVYGGFKFVTPAEVEPGLFERTLTMNGVSKAYAMTGWRIGYAAGPA 255 Query: 248 DIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDRL-VSMGL 306 + K + + S A SI+Q AA+ A+ D R+ +++R D V L + L Sbjct: 256 PLIKAMDLLQGQQTSGACSIAQWAAVAALEGPQDHLASFRKAFEERRDLVVSMLNQAAHL 315 Query: 307 DVVKPSGAFYIFPS-IKSFGMTS---------FDFSMALLEDAGVALVPGSSFSTYGEGY 356 + P GAFY+FPS + G T+ DF LLE GVA+V GS+F T G + Sbjct: 316 NCPTPEGAFYVFPSCAAAIGKTTAAGKQIASDADFVAELLEAEGVAVVQGSAFGT-GPNF 374 Query: 357 VRLSFACSMDTLREGLDRLELFVLKKR 383 R+S+A S + L +++ F R Sbjct: 375 -RVSYAASTELLERACAKIQRFCASLR 400 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 16 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 400 Length adjustment: 31 Effective length of query: 362 Effective length of database: 369 Effective search space: 133578 Effective search space used: 133578 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory