Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_010627682.1 BZY95_RS19635 acetolactate synthase small subunit
Query= BRENDA::P00894 (163 letters) >NCBI__GCF_002151265.1:WP_010627682.1 Length = 163 Score = 209 bits (533), Expect = 1e-59 Identities = 101/162 (62%), Positives = 137/162 (84%), Gaps = 1/162 (0%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 MR I+S+L+ENE GALSRV+GLFSQR +NIE+L VAPT+DP+LSR+T+ TVGD++V+EQI Sbjct: 1 MRHIISILMENEPGALSRVVGLFSQRNFNIETLNVAPTEDPSLSRLTVTTVGDDRVIEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 K L+KL+DV+++ +L +G H+ERE+MLVK++A G RDEVKR +IFR QI+DVTPSLY Sbjct: 61 TKHLNKLIDVIKLVDLTEGNHIERELMLVKVKALGAARDEVKRTVDIFRAQIVDVTPSLY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIM 162 TVQ+ G + KLDAFL ++ V I+EVAR+GV G++RGDK++ Sbjct: 121 TVQITGDAPKLDAFLQAMGPVG-ILEVARTGVSGIARGDKVL 161 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 163 Length adjustment: 18 Effective length of query: 145 Effective length of database: 145 Effective search space: 21025 Effective search space used: 21025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate WP_010627682.1 BZY95_RS19635 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.12591.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.12591.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.