Align branched-chain-amino-acid aminotransferase; EC 2.6.1.42 (characterized)
to candidate WP_027490420.1 LRK54_RS10340 branched-chain amino acid transaminase
Query= CharProtDB::CH_024500 (309 letters) >NCBI__GCF_021560695.1:WP_027490420.1 Length = 333 Score = 347 bits (891), Expect = e-100 Identities = 176/301 (58%), Positives = 219/301 (72%), Gaps = 1/301 (0%) Query: 8 YIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRLHDSAKI 67 ++W NG + W +A VHV +HALHYG+SVFEG R Y + +GP FR +H +RL +SA++ Sbjct: 5 FLWHNGRIKPWAEASVHVSTHALHYGSSVFEGERVYATPRGPAYFRLADHTRRLFESARV 64 Query: 68 YRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDVIIAAFPW 127 Y V S DE+ AC ++IR N + SAY+RP++F G G+GV G +V I A W Sbjct: 65 YEIEVGYSEDEINAACLELIRANAMPSAYVRPIVFRGAGGLGVLAKDGAPVEVAIMAMAW 124 Query: 128 GAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQEGIALD 187 GAYLG EA E+G D VSSW+R APNTIP+ AKAGGNYLSS L+G EARR+GY EGIAL Sbjct: 125 GAYLG-EAAERGADICVSSWHRPAPNTIPSWAKAGGNYLSSQLIGLEARRNGYDEGIALG 183 Query: 188 VNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQVLSRESL 247 G +SEGAGENLF VK+G L TPP ++ L GITRD+++ LA LGI V E+ L RE+L Sbjct: 184 HGGLLSEGAGENLFLVKNGRLLTPPSSAGILAGITRDSVLALAAGLGIAVEERELPREAL 243 Query: 248 YLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKWGWLDQV 307 Y ADEVFM+GTAAEITPVRSVD VG+G GPVT++++QAFFGLF G TED+ GWL V Sbjct: 244 YSADEVFMTGTAAEITPVRSVDRKAVGKGAPGPVTQQLRQAFFGLFDGRTEDRHGWLSVV 303 Query: 308 N 308 N Sbjct: 304 N 304 Lambda K H 0.319 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 331 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 333 Length adjustment: 28 Effective length of query: 281 Effective length of database: 305 Effective search space: 85705 Effective search space used: 85705 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory